DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnaja2b

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_997830.1 Gene:dnaja2b / 324164 ZFINID:ZDB-GENE-030131-2884 Length:413 Species:Danio rerio


Alignment Length:395 Identity:100/395 - (25%)
Similarity:163/395 - (41%) Gaps:83/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPD-STHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            |.:|||:..|:..:::.|:..|||.|||| :.::..|   |:|:|.||.:||:..|:..||:.| 
Zfish    10 YDLLGVSPSASENELKKAYRKLAKEYHPDKNPNAGDK---FKEISFAYEVLTNPEKKDLYDRYG- 70

  Fly   166 IKDERAFLEQAGNPLNVGLEEAKKF------------DSDKTTN-------DEINKLKSNEFDLP 211
               |:...|..|.  ..|:|:....            .|.|:.|       |.|:.||.:..|| 
Zfish    71 ---EQGLREGGGG--GAGMEDIFSHIFGGGLFGFMGGQSSKSRNGGRRRGEDMIHPLKVSLEDL- 129

  Fly   212 LDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGK----EPCRRCNGTG-KVMTKTPTFSS 271
                  ..|...:::|.....|..|.|:.        ||    :.|..|.|.| ::|.:......
Zfish   130 ------YNGKTTKLQLSKNVLCSACNGQG--------GKTGAVQKCSTCRGRGMRIMIRQLAPGM 180

  Fly   272 V----NTCTQC--KGKRFTNRNDCETCSNRGFVVSNVDVM-VSVPSGSRDGDVVNII-----NPE 324
            |    :.||.|  :|:....::.|:.|..|. |...|.|: |.|..|.:.|..:...     :|.
Zfish   181 VQQMQSVCTDCNGEGEVIHEKDRCKECDGRK-VCKEVKVLEVHVDKGMKHGQKITFSGEADQSPN 244

  Fly   325 TKQ-QVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGL--------YESVELRVEP 380
            |:. .:...|.....:.|||.|||:.....:.:.||:.|..|.:..|        |...:: |||
Zfish   245 TEPGDIILVLQEKDHEEFRRDGNDLHIGHKIGLVEALCGFQFMLTHLDGRHLVIKYPPGKV-VEP 308

  Fly   381 GTQSHTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVKQRQLV----LALSQAEDPVFEPK 438
            |:..    |:.|:|:   |:....|:..:...|:.|.|..:...:|.    |..|:.|.||....
Zfish   309 GSIR----VVRGEGMPQYRNPFEKGDLFIKFDVQFPENGWISTEKLSELEDLLPSRTEVPVISAD 369

  Fly   439 TKSTE 443
            |:..:
Zfish   370 TEEVD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 96/381 (25%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908 17/73 (23%)
DnaJ_C 298..416 CDD:199909 33/135 (24%)
dnaja2bNP_997830.1 PTZ00037 4..413 CDD:240236 100/395 (25%)
DnaJ 9..67 CDD:278647 22/59 (37%)
DnaJ_C 116..342 CDD:199909 59/246 (24%)
DnaJ_zf 145..211 CDD:199908 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.