DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnaja1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_955956.1 Gene:dnaja1 / 323922 ZFINID:ZDB-GENE-030131-2642 Length:398 Species:Danio rerio


Alignment Length:344 Identity:80/344 - (23%)
Similarity:153/344 - (44%) Gaps:80/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            :|.:|||...|:.::::.|:..||.:||||...:|.  :.|:::|.||.:|:|..||..||: ||
Zfish     7 FYDMLGVKPSASPEELKKAYRKLALKYHPDKNPTEG--EKFKQISQAYEVLSDAKKREVYDR-GG 68

  Fly   166 IKDERAFLEQAGN-----PLNVGLEEAKKFD----------SDKTTNDEINKLKSNEFDLPLDFL 215
               |:| :::.||     |:::       ||          .::...:.:::|..:..||     
Zfish    69 ---EKA-IKEGGNGGSCSPMDI-------FDLFFGGGGRMHRERRGKNVVHQLTVSLEDL----- 117

  Fly   216 EATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGK----EPCRRCNGTG---KVMTKTP-TFSSV 272
              ..|..:::.|:....|:.|:|:.        |:    |.|..|.|.|   ::....| ....:
Zfish   118 --YNGTTRKLALQKNVICDKCEGRG--------GRKGVIEVCPLCRGVGVQVRLHHLAPGMVQQI 172

  Fly   273 NT-CTQC--KGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQ------ 328
            :| |..|  :|:|..:|:.|:||:.|..:.....:.|.:..|.:||..: :.:.|..|:      
Zfish   173 STVCEGCQGQGQRLGHRDRCKTCTGRKILRQKKILEVHIDKGMKDGQKI-VFHGEGDQEPGLKPG 236

  Fly   329 -VTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVEL-------RVEPGTQSH 385
             :...|...:...:.|.|:|::....|.:.|::.|....|:.|.....|       .::||.:  
Zfish   237 DIIIVLDQRAHPLYTRQGDDLIVSMELQLVESLCGFQKPIKTLDSRTLLITSHPGELIKPGDK-- 299

  Fly   386 TQVVLNGKGVRSREGVGNH 404
             :.|:|       ||:..|
Zfish   300 -KCVMN-------EGMPMH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 80/344 (23%)
DnaJ 101..161 CDD:278647 21/59 (36%)
DnaJ_zf 233..296 CDD:199908 19/73 (26%)
DnaJ_C 298..416 CDD:199909 23/121 (19%)
dnaja1NP_955956.1 PTZ00037 2..395 CDD:240236 80/344 (23%)
DnaJ 7..65 CDD:278647 21/59 (36%)
DnaJ_C 104..330 CDD:199909 48/233 (21%)
DnaJ_zf 133..199 CDD:199908 19/73 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.