DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajb5

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:390 Identity:88/390 - (22%)
Similarity:142/390 - (36%) Gaps:110/390 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 MPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEY 160
            |.|| |||:||:...|...:|:.|:..:|.:||||........:.|:|::.||::|:|..||..|
  Rat    73 MGKD-YYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLY 136

  Fly   161 DQLG--GIK-------------------DERAFLEQ---AGNPLNVGLEEAKK------FDSDKT 195
            ||.|  |:|                   |..|....   ..||.::....::.      ||.|..
  Rat   137 DQYGEEGLKTGGGTSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDM 201

  Fly   196 TNDE------------INKLKSNEFDLPLDFL------EATVGCKKRIELRYLRKCETCKGKSQL 242
            ..||            .|.|.......|....      :..|..:.|:.|.     |...|.::.
  Rat   202 DVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLE-----EIYHGSTKR 261

  Fly   243 MAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVS 307
            |      |...||.|..|:.:.                   |..........||:   .....::
  Rat   262 M------KITRRRLNPDGRTVR-------------------TEDKILHIVIKRGW---KEGTKIT 298

  Fly   308 VPSGSRDGDVVNIINPET-KQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLY 371
            .|   ::||.    .|:. ...:.:.|......:|||.|.::|....:::.||:.|.:..|    
  Rat   299 FP---KEGDA----TPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNI---- 352

  Fly   372 ESVELRV---------EPGTQSHTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVKQRQLV 424
            .:::.||         :|||...    |.|:|:   :.....|:.||..|||.|..|:.:.||::
  Rat   353 PTIDGRVIPLPCNDVIKPGTVKR----LRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQIL 413

  Fly   425  424
              Rat   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 85/385 (22%)
DnaJ 101..161 CDD:278647 21/59 (36%)
DnaJ_zf 233..296 CDD:199908 9/62 (15%)
DnaJ_C 298..416 CDD:199909 29/130 (22%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 88/390 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.