DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnaja4

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:459 Identity:112/459 - (24%)
Similarity:183/459 - (39%) Gaps:117/459 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RQREAKRTS-AGATPQQVSSPAVKYP-------------QSRGMPKD--------------YYYK 103
            |||....|. ..:||:   :||.::|             :|.|.|::              .||.
  Rat   106 RQRPTSTTKPESSTPK---TPATEHPNMARGGNQNWSSGESDGQPEEQTSEENGDKMVKETQYYD 167

  Fly   104 VLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLG--GI 166
            :|||...|:.::|:.|:..||.:||||....|.  :.|:.:|.||.:|:|..||..|||.|  .|
  Rat   168 ILGVKPSASPEEIKKAYRKLALKYHPDKNPDEG--EKFKLISQAYEVLSDPKKRDIYDQGGEQAI 230

  Fly   167 KDERAFLEQAGNPLNVGLEEAKKFD-----SDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIE 226
            |:..:......:|:::       ||     ..:.|.:...|...::..:.|:.|..  |..|::.
  Rat   231 KEGGSGSPSFSSPMDI-------FDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYN--GITKKLA 286

  Fly   227 LRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTG--------------KVMTKTPTFSSVNTCTQ 277
            |:....||.|:|    :..:....|.|..|.|.|              ::.|         .|.:
  Rat   287 LQKNIICEKCEG----IGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQT---------VCIE 338

  Fly   278 CK--GKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQ-------VTYRL 333
            ||  |:|...::.||.||..........:.|.|..|.:||..: :.:.|..|:       |...|
  Rat   339 CKGQGERINPKDRCEDCSGAKVTREKKIIEVHVDKGMKDGQKI-LFHGEGDQEPELEPGDVIIVL 402

  Fly   334 SVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNG--KGVR 396
            .......|:|.|:|::....:.:|||:.|....|:.|.:    ||...:....:|:.:|  |.||
  Rat   403 DQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDD----RVLIISSKSGEVIKHGDLKCVR 463

  Fly   397 SREGV---------GNHIVTLKVRIPRN--LSVKQ----------RQLVLA---LSQAEDPVFEP 437
            : ||:         |..|:...|..|..  ||:::          ||.|..   :.|.|...|.|
  Rat   464 N-EGMPIYKAPLEKGMLIIQFLVVFPEKQWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEFNP 527

  Fly   438 KTKS 441
            ..:|
  Rat   528 NEQS 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 96/385 (25%)
DnaJ 101..161 CDD:278647 23/59 (39%)
DnaJ_zf 233..296 CDD:199908 19/78 (24%)
DnaJ_C 298..416 CDD:199909 32/137 (23%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 102/418 (24%)
DnaJ 165..223 CDD:278647 23/59 (39%)
DnaJ_C 264..490 CDD:199909 57/246 (23%)
DnaJ_zf 293..359 CDD:199908 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.