DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajc10

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001099956.2 Gene:Dnajc10 / 295690 RGDID:1307813 Length:793 Species:Rattus norvegicus


Alignment Length:472 Identity:89/472 - (18%)
Similarity:160/472 - (33%) Gaps:188/472 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPD------STHSEQKLKHFQELSNAYNILTDETKRLE 159
            :|.:|||::.|:.::||.||..||.:.|||      :.|.:     |.:::.||.:|.||..|.:
  Rat    36 FYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGD-----FLKINRAYEVLKDEDLRKK 95

  Fly   160 YDQLG--GIKDERAFLEQAGN-------PLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFL 215
            ||:.|  |::|     .|.|.       ..:.|:     :|.|    .||..|:..|||..::..
  Rat    96 YDKYGEKGLED-----NQGGQYESWSYYRYDFGI-----YDDD----PEIITLERREFDAAVNSG 146

  Fly   216 EA------TVGCKKRIEL-----RYLRKCE--------TCKGKSQLMAHRDVGKEP--------- 252
            |.      :.||....:|     .:.::.:        .|.....|...:.|...|         
  Rat   147 ELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGM 211

  Fly   253 -CRRCNG--------------TGKVMTKTPTFSSVNT------------CTQC-KGKRFTNRNDC 289
             ..:.||              ....:|:..|.:.||.            .|.| ||:      ||
  Rat   212 AAVKYNGDRSKESLVSFAMQHVRTTVTELSTGNFVNAIETAFAAGIGWLITFCFKGE------DC 270

  Fly   290 ET---------------------CSNRGFVVSNVDVMVSV----PSGSRDGDVVNIINPETKQQV 329
            .|                     |..:..:..::|...|.    |.|:       .:|.:.|..|
  Rat   271 LTPQTRLRLSGMLDGLVNVGWVDCDTQDSLCKSLDATASTTAYFPPGA-------TLNNKEKSSV 328

  Fly   330 TYRLSVPSSDYFRRVGNDI----------LTD--------------KHLNISEAILGGSFQIRGL 370
            .:..|:.:.:.:..:.:::          |.|              |:.|.::..|.   :::.|
  Rat   329 LFLNSLDAKEIYMEIIHNLPDFELLSANKLEDRLAHHRWLVFFHFGKNENANDPELK---KLKTL 390

  Fly   371 YESVELRV-------EPGTQSHTQV------VLNGKGVR-----------------SREGVGNHI 405
            .::..::|       .||..|...|      |..|:|.:                 ::|.|.:|:
  Rat   391 LKNEHIQVGRFDCSSAPGICSDLYVFQSCLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHV 455

  Fly   406 VTLKVRIPRNLSVKQRQ 422
            .||.   |:|.....::
  Rat   456 TTLG---PQNFPASDKE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 89/472 (19%)
DnaJ 101..161 CDD:278647 22/65 (34%)
DnaJ_zf 233..296 CDD:199908 18/128 (14%)
DnaJ_C 298..416 CDD:199909 28/175 (16%)
Dnajc10NP_001099956.2 DnaJ 34..>132 CDD:223560 33/114 (29%)
DnaJ 35..97 CDD:278647 22/65 (34%)
PDI_a_ERdj5_N 129..229 CDD:239301 16/99 (16%)
ER_PDI_fam 130..551 CDD:273457 57/359 (16%)
Trxb 1 235..350 20/127 (16%)
Trxb 2 348..463 20/120 (17%)
PDI_a_ERdj5_C 453..550 CDD:239302 5/20 (25%)
PDI_a_ERdj5_C 556..663 CDD:239302
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.