DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7387 and SPBC543.02c

DIOPT Version :9

Sequence 1:	NP_648186.3	Gene:	CG7387 / 38915	FlyBaseID:	FBgn0035852	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	NP_596790.1	Gene:	SPBC543.02c / 2541066	PomBaseID:	SPBC543.02c	Length:	476	Species:	Schizosaccharomyces pombe

Alignment Length:	121	Identity:	35/121 - (28%)
Similarity:	50/121 - (41%)	Gaps:	35/121 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    98 KDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLK-HFQELSNAYNILTDETKRLEYD 161
            || :||:|||::.||..:|:.|:..||..||||......:.: .|:|:..||.||:|...|..:|
pombe   348 KD-HYKILGVSKEATDIEIKKAYRKLALVYHPDKNAGNLEAEARFKEVGEAYTILSDPESRRRFD 411

  Fly   162 QLGGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEA 217
                          :|..|..|:|.....|                   |.|.|.|
pombe   412 --------------SGVDLEPGMEGGAGMD-------------------PFDILRA 434

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7387	NP_648186.3	DnaJ_bact	101..431	CDD:274090	33/118 (28%)
		DnaJ	101..161	CDD:278647	23/60 (38%)
		DnaJ_zf	233..296	CDD:199908
		DnaJ_C	298..416	CDD:199909
SPBC543.02c	NP_596790.1	TPR_11	23..90	CDD:290150
		TPR repeat	23..51	CDD:276809
		TPR_1	29..52	CDD:278916
		TPR repeat	56..88	CDD:276809
		TPR repeat	93..117	CDD:276809
		TPR repeat	146..171	CDD:276809
		TPR_11	147..208	CDD:290150
		TPR_11	176..254	CDD:290150
		TPR_2	177..210	CDD:285020
		TPR repeat	177..205	CDD:276809
		TPR	227..256	CDD:197478
		TPR repeat	227..251	CDD:276809
		TPR repeat	256..290	CDD:276809
		TPR_11	261..325	CDD:290150
		TPR repeat	295..323	CDD:276809
		DnaJ	348..>430	CDD:223560	32/115 (28%)
		DnaJ	349..411	CDD:278647	24/62 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910