DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and SPBC17A3.05c

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_595587.1 Gene:SPBC17A3.05c / 2540130 PomBaseID:SPBC17A3.05c Length:403 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:35/133 - (26%)
Similarity:63/133 - (47%) Gaps:15/133 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KPAYYPDRQ--REAKRTSAGATPQQVSS-------PAVKYPQSRGMPKDYYYKVLGVNRHATIQQ 115
            |..::.::|  ||...:|||...|:.:|       ..:||...:      ||::|.:.:..|..:
pombe    70 KSNFFSEKQSVRENGNSSAGEKKQKWTSEQHLLVQKIIKYKNHQ------YYEILDLKKTCTDTE 128

  Fly   116 IRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGGIKDERAFLEQAGNPL 180
            |:.::..||.:.|||..|:....:.|:.:|.|:.:|:|...|..||:.|...:.||....:....
pombe   129 IKKSYKKLALQLHPDKNHAPSADEAFKMVSKAFQVLSDPNLRAHYDRTGMDPESRASAASSSFSS 193

  Fly   181 NVG 183
            |.|
pombe   194 NAG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 24/83 (29%)
DnaJ 101..161 CDD:278647 17/59 (29%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
SPBC17A3.05cNP_595587.1 DnaJ 114..>220 CDD:223560 24/83 (29%)
DnaJ 114..174 CDD:278647 17/59 (29%)
DUF1977 295..391 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.