DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and mug184

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_595124.1 Gene:mug184 / 2540016 PomBaseID:SPBC1773.09c Length:551 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:45/147 - (30%)
Similarity:69/147 - (46%) Gaps:29/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDST--HSEQKLKHFQELSNAYNILTDETKRLEYDQL 163
            ||.:|.:.::||.||||..:..||.:||||..  ..|:.:|.||.|..|:.:|:|.||||.||||
pombe    13 YYAILKLQKNATFQQIRKQYLFLALQYHPDRNPGDEERAVKRFQRLQLAHEVLSDATKRLIYDQL 77

  Fly   164 GGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTND--------EINKLKSNEFDLPLDFLEATVG 220
            .|:                ......::..:.|:|.        ..||.|::::..|  |...|..
pombe    78 FGL----------------STRTRSQYKPNSTSNPSKHTSAYASYNKGKNSKWSSP--FASTTKK 124

  Fly   221 CKKRIELRYLRKCETCK 237
            .::..| :|.:|..|.|
pombe   125 PQESSE-KYSKKSSTRK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 45/147 (31%)
DnaJ 101..161 CDD:278647 27/61 (44%)
DnaJ_zf 233..296 CDD:199908 2/5 (40%)
DnaJ_C 298..416 CDD:199909
mug184NP_595124.1 DnaJ 11..>79 CDD:223560 31/65 (48%)
DnaJ 12..75 CDD:278647 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44145
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.