DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and mdj1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_587824.1 Gene:mdj1 / 2539501 PomBaseID:SPCC4G3.14 Length:528 Species:Schizosaccharomyces pombe


Alignment Length:431 Identity:118/431 - (27%)
Similarity:190/431 - (44%) Gaps:61/431 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QREAKRT-SAGATPQQVSSPAVKYPQSRGM-----PKDYYYKVLGVNRHATIQQIRSAFYALAKR 126
            ||.|||. |..|..:..|..|..:..:|.:     |    ||.|||::.|:..:|:||:|.|||:
pombe    52 QRNAKREFSRCAALKNFSYHARCFHATRAVWEMTDP----YKTLGVSKSASASEIKSAYYKLAKQ 112

  Fly   127 YHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLG-------------------GIKDERAF 172
            ||||:...:.....|.|:..||.:|.|..|:..:|..|                   |.....:|
pombe   113 YHPDANPDKAAQDKFVEIKQAYEVLQDPKKKKAFDTYGAGAFKNGEFTGGDFEGFQNGFAGASSF 177

  Fly   173 LEQAGNPLNVGLEEAKKFDS-----DKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRYLRK 232
              .:|.| ....|:...|.|     .:.|:.::...:..|..:.:||:||..|.||.:.......
pombe   178 --SSGFP-GFNFEDLFGFSSRGPQARRNTSFDVFVGEDIEASITIDFMEAVRGAKKDLSYSVSST 239

  Fly   233 CETCKGKS-QLMAHRDVGKEPCRRCNGTG-KVMTKTPTFSSVNTCTQCKGKRFT--NRNDCETCS 293
            |.:|.|.. |..:|    |..|..|.||| ::....|:|....||..|.|...|  ..:.|.:|.
pombe   240 CSSCHGSGLQPGSH----KSTCFACKGTGQRLHFIPPSFHMQTTCDSCGGTGTTIPPNSACRSCM 300

  Fly   294 NRGFVVSNVDVMVSVPSGSRDGDVVNII-----------NPETKQQ---VTYRLSVPSSDYFRRV 344
            ..|.|.....|.:.:|.|..|..|:.::           .|..|.:   :...:.|....:|.|.
pombe   301 GSGTVRERKTVSIDIPPGIDDNTVLRVMGAGNDASTAKGGPNAKSRPGDLFATIHVRKHPFFVRE 365

  Fly   345 GNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKGVR--SREGVGNHIVT 407
            |.::..:..:.::.|.|||:.::..|..:|:|||.|||.:..::.:.|||:|  :....||..|.
pombe   366 GTNVTYNAKIPMTTAALGGTLRVPTLTGNVDLRVSPGTSTGDRITMAGKGIRKVNTSRYGNFYVN 430

  Fly   408 LKVRIPRNLSVKQRQLVLALSQAEDPVFEPKTKSTEAGNLS 448
            .:|.||:.||..:|.|:..|:.|.:.....:|:|:.:|..|
pombe   431 FEVTIPKILSPHERSLLEQLADALNDSTARRTQSSPSGTNS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 102/373 (27%)
DnaJ 101..161 CDD:278647 24/59 (41%)
DnaJ_zf 233..296 CDD:199908 20/66 (30%)
DnaJ_C 298..416 CDD:199909 34/133 (26%)
mdj1NP_587824.1 DnaJ 82..457 CDD:223560 104/385 (27%)
DnaJ 86..147 CDD:278647 25/64 (39%)
DnaJ_zf 243..303 CDD:199908 19/63 (30%)
DnaJ_C 304..439 CDD:199909 34/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53632
OrthoFinder 1 1.000 - - FOG0001676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.