powered by:
Protein Alignment CG7387 and DNAJC16
DIOPT Version :9
Sequence 1: | NP_648186.3 |
Gene: | CG7387 / 38915 |
FlyBaseID: | FBgn0035852 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_056106.1 |
Gene: | DNAJC16 / 23341 |
HGNCID: | 29157 |
Length: | 782 |
Species: | Homo sapiens |
Alignment Length: | 74 |
Identity: | 28/74 - (37%) |
Similarity: | 43/74 - (58%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 YKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGGI 166
|:||||:|.|:...|:.|:..||:.:|||..........|.::|.||.||::|.||..|||.|..
Human 31 YRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDKFIQISKAYEILSNEEKRSNYDQYGDA 95
Fly 167 KDERAFLEQ 175
.:.:.:.:|
Human 96 GENQGYQKQ 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0715 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.