DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnj-14

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001257015.1 Gene:dnj-14 / 180746 WormBaseID:WBGene00001032 Length:217 Species:Caenorhabditis elegans


Alignment Length:280 Identity:68/280 - (24%)
Similarity:108/280 - (38%) Gaps:88/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RQREAKRTSAGATPQQVSSPAVKYPQSRGMPKD--YYYKVLGVNRHATIQQIRSAFYALAKRYHP 129
            |:.|..|||.||:|:: .|||..:...   ||.  :.|.|||:.::||..:|:.|:..||.||||
 Worm     7 REAEEGRTSGGASPRE-ESPAADHSHD---PKKGLHLYNVLGIQKNATDDEIKKAYRKLALRYHP 67

  Fly   130 DST--HSEQKLKHFQELSNAYNILTDETKRLEYDQLGGIKDERAFLEQAGNPLNVGLEEAKKFDS 192
            |..  ...:|.:.|:|::.|..:|::..||..||::|                ..||:..::|..
 Worm    68 DKNLDGDPEKTEMFKEINYANAVLSNPNKRRVYDEMG----------------ETGLKLMEQFGE 116

  Fly   193 DKTTNDEINK--LKSNEFDLPL---DFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEP 252
            |:.....:.|  .|...|...|   .|.....||        :..|:.|                
 Worm   117 DEKILQWMLKPWFKWTFFAFGLLTGGFFCCCCGC--------MCCCQCC---------------- 157

  Fly   253 CRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDV 317
                                  |..|.|| :..::|.|....    .|:.||:|..|:.|..   
 Worm   158 ----------------------CNFCCGK-YKPKHDDEFADE----TSDGDVIVDQPTASEP--- 192

  Fly   318 VNIINPET-KQQVTYRLSVP 336
                .|:| .:||...:::|
 Worm   193 ----MPDTNNRQVPIVIAMP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 55/244 (23%)
DnaJ 101..161 CDD:278647 22/61 (36%)
DnaJ_zf 233..296 CDD:199908 8/62 (13%)
DnaJ_C 298..416 CDD:199909 11/40 (28%)
dnj-14NP_001257015.1 DnaJ 39..101 CDD:365959 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.