powered by:
Protein Alignment CG7387 and F54F2.9
DIOPT Version :9
Sequence 1: | NP_648186.3 |
Gene: | CG7387 / 38915 |
FlyBaseID: | FBgn0035852 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498949.2 |
Gene: | F54F2.9 / 176241 |
WormBaseID: | WBGene00018836 |
Length: | 414 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 15/63 - (23%) |
Similarity: | 32/63 - (50%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQL 163
:|:...:.|.|:..|::.|:..|...:|||...:....:.|::::..|.:|.....|.:||.:
Worm 36 FYEWFDIPRDASSNQVKKAYRKLTLEWHPDRNSAPDATEKFRQVAGIYEVLKTTELREKYDNV 98
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.