DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnj-18

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_497962.1 Gene:dnj-18 / 175616 WormBaseID:WBGene00001036 Length:249 Species:Caenorhabditis elegans


Alignment Length:139 Identity:42/139 - (30%)
Similarity:72/139 - (51%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDS--THSEQKLKHFQELSNAYNILTDETKRLEYDQL 163
            :|||||:.:.|:.:.|:||:|.|:|::|||:  |:.|:..|.|.:::.||.||:.|.||..|| :
 Worm    25 HYKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNKEEAAKKFHQVAMAYEILSSEDKRKAYD-M 88

  Fly   164 GGIK------DERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLK------SNEFDLPLDFLE 216
            ..|:      |..:|..:.....:..|::....|.|....:...:..      .:.||:|.:|..
 Worm    89 TRIRTSPMPNDPSSFSNRYRRRTSSNLKQYTDIDIDYKDFEHFQRSTRRRPQYHSHFDMPNEFYA 153

  Fly   217 ATVGCKKRI 225
            ...|.|||:
 Worm   154 EFGGFKKRV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 42/139 (30%)
DnaJ 101..161 CDD:278647 26/61 (43%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
dnj-18NP_497962.1 PRK14300 23..>181 CDD:172788 42/139 (30%)
DnaJ 23..>88 CDD:223560 28/63 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166354
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.