DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnj-4

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_491558.1 Gene:dnj-4 / 172173 WormBaseID:WBGene00001022 Length:274 Species:Caenorhabditis elegans


Alignment Length:132 Identity:41/132 - (31%)
Similarity:60/132 - (45%) Gaps:38/132 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYD-QLG 164
            :|:||||...||:.:|:|||||.:|:.|||::..|.....|.||.|||::|.....|..|| ||.
 Worm    29 HYEVLGVESTATLSEIKSAFYAQSKKVHPDNSSEESATASFLELKNAYDVLRRPADRRLYDYQLR 93

  Fly   165 G-----------------------IKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSN 206
            |                       .:|...:..|  ||           |:.:::.:|.:| .|.
 Worm    94 GGGGRYPNGGQRYQYPNTAPQYDFSRDWSTYWSQ--NP-----------DNSRSSREERDK-SSR 144

  Fly   207 EF 208
            ||
 Worm   145 EF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 41/132 (31%)
DnaJ 101..161 CDD:278647 26/59 (44%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
dnj-4NP_491558.1 CbpA 27..>155 CDD:225124 41/132 (31%)
DnaJ 28..89 CDD:365959 26/59 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.