DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajc1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001177746.1 Gene:Dnajc1 / 13418 MGIID:103268 Length:552 Species:Mus musculus


Alignment Length:136 Identity:36/136 - (26%)
Similarity:55/136 - (40%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQ--L 163
            :|:.|||.:.|:...||.|:..|:...|||....|.....|::|...|.:|.|:.:|..||.  :
Mouse    62 FYEFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDVLI 126

  Fly   164 GGIKDER--AFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIE 226
            .|:.|.|  .|..:                       .:.|:.:.|..|.| |:..|||....:.
Mouse   127 NGLPDWRQPVFYYR-----------------------RVRKMSNAELALLL-FIILTVGHYAVVW 167

  Fly   227 LRYLRK 232
            ..||.|
Mouse   168 SIYLEK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 36/136 (26%)
DnaJ 101..161 CDD:278647 19/59 (32%)
DnaJ_zf 233..296 CDD:199908 36/136 (26%)
DnaJ_C 298..416 CDD:199909
Dnajc1NP_001177746.1 DnaJ 61..122 CDD:278647 19/59 (32%)
SANT 327..373 CDD:238096
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..495
SANT 493..542 CDD:197842
SANT 494..541 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.