DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AgaP_AGAP012747

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_307339.3 Gene:AgaP_AGAP012747 / 1268770 VectorBaseID:AGAP012747 Length:210 Species:Anopheles gambiae


Alignment Length:87 Identity:28/87 - (32%)
Similarity:42/87 - (48%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQ---KLKHFQELSNAYNILTDETKRLEYDQ 162
            :|.||.:..:.:.:.:|:||..|:|..|||:..|.|   ..|.|.||..||.:|:....|..||.
Mosquito    23 HYNVLKLQPNCSARDVRTAFIQLSKELHPDANVSNQAKYDKKSFVELLEAYKVLSKPESRAAYDY 87

  Fly   163 LGGIKDERAFLEQAGNPLNVGL 184
                  |.:..:..||.:.|.|
Mosquito    88 ------ELSLSKNPGNQVYVNL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 28/87 (32%)
DnaJ 101..161 CDD:278647 21/62 (34%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
AgaP_AGAP012747XP_307339.3 DnaJ 22..86 CDD:278647 21/62 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.