DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and DNAJC24

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_859057.4 Gene:DNAJC24 / 120526 HGNCID:26979 Length:149 Species:Homo sapiens


Alignment Length:154 Identity:40/154 - (25%)
Similarity:65/154 - (42%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 MPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHS-------EQKLKHFQELSNAYNILTD 153
            |||..:|.:||.:..|.|..::..:..|...||||...:       |:.::.|.|:..|:.||.:
Human     7 MPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGN 71

  Fly   154 ETKRLEYDQLGGIKDERAFLEQAGNPL-NVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEA 217
            |..:.|||           |::..:.| |||..:|:.:         :.::..||.|... :|..
Human    72 EETKREYD-----------LQRCEDDLRNVGPVDAQVY---------LEEMSWNEGDHSF-YLSC 115

  Fly   218 TVG-----CKKRIELRYLRKCETC 236
            ..|     .|...|...|..|:||
Human   116 RCGGKYSVSKDEAEEVSLISCDTC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 37/149 (25%)
DnaJ 101..161 CDD:278647 18/66 (27%)
DnaJ_zf 233..296 CDD:199908 3/4 (75%)
DnaJ_C 298..416 CDD:199909
DNAJC24NP_859057.4 DnaJ 11..79 CDD:365959 18/67 (27%)
zf-CSL 99..148 CDD:368338 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.