DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and zgc:152986

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001275586.1 Gene:zgc:152986 / 101884054 ZFINID:ZDB-GENE-061013-762 Length:177 Species:Danio rerio


Alignment Length:107 Identity:36/107 - (33%)
Similarity:54/107 - (50%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            ||.||||:|..:.:.|:.||:.||.::|||...:....:.|..::.||.:|:|..||..|||   
Zfish    23 YYSVLGVSRFVSSRDIKKAFHKLALKHHPDKNQTPNAQQTFTHIAQAYEVLSDREKRRVYDQ--- 84

  Fly   166 IKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNE 207
                   ::...|| :.|.|...|.|.   |.|..:.|.||:
Zfish    85 -------MDHLSNP-DQGSERMVKKDQ---TEDMGSNLFSNK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 36/107 (34%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
zgc:152986NP_001275586.1 DnaJ 22..83 CDD:278647 22/59 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.