DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajc1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_002728560.1 Gene:Dnajc1 / 100360412 RGDID:2322144 Length:565 Species:Rattus norvegicus


Alignment Length:177 Identity:44/177 - (24%)
Similarity:69/177 - (38%) Gaps:36/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQ--L 163
            :|:.|||.:.|:...||.|:..|:...|||....|.....|::|...|.:|.|:.:|..||.  :
  Rat    73 FYEFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDILI 137

  Fly   164 GGIKDER--AFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIE 226
            .|:.|.|  .|..:                       .:.|:.:.|..|.| |:..|||....:.
  Rat   138 NGLPDWRQPVFYYR-----------------------RVRKMSNAELALLL-FIILTVGHYAVVW 178

  Fly   227 LRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVN 273
            ..||.     |...:|::.:   |...:|..|:..|....|..|..|
  Rat   179 SIYLE-----KQLDELLSRK---KREKKRKTGSKSVDAAKPGASERN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 44/177 (25%)
DnaJ 101..161 CDD:278647 19/59 (32%)
DnaJ_zf 233..296 CDD:199908 9/41 (22%)
DnaJ_C 298..416 CDD:199909
Dnajc1XP_002728560.1 DnaJ 72..133 CDD:278647 19/59 (32%)
SANT 338..384 CDD:238096
SANT 506..555 CDD:197842
SANT 507..554 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.