DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18a and HSV2

DIOPT Version :9

Sequence 1:NP_001261565.1 Gene:Atg18a / 38913 FlyBaseID:FBgn0035850 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_011739.1 Gene:HSV2 / 853138 SGDID:S000003455 Length:448 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:77/323 - (23%)
Similarity:142/323 - (43%) Gaps:67/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNFNQNITSLAVATSGGYSLYSLGSVDSTLDKIY------HTKSDELFLIERLFESSLVAIVS-- 73
            |:|||:.:..:||...|:.:::...:.|.|.|.:      .::...:.....|:.::.:|:|.  
Yeast    22 VSFNQDDSCFSVALENGFRIFNTDPLTSKLSKTFKESATNQSRGTGIGYTRMLYRTNYIALVGGG 86

  Fly    74 ---QRAPRKLKVCHFKKQSEICNYSYANTILAVKLNRERLIVCLEESLYIHNIQDMKVVHTIRDT 135
               :.|..||.:.....|.|.....:.::|..|.|:|..::|.||.::.|...|           
Yeast    87 KRPRHALNKLIIWDDLLQKETITLKFMSSIKDVFLSRIHIVVVLENTIEIFQFQ----------- 140

  Fly   136 PCNPQGLCALSS------------SSEHC-------------YLAYPGSVTAGEVQIFDAIN--- 172
             .|||.:|.:..            ||:|.             .:|:|.:...|::|:.|...   
Yeast   141 -TNPQRICPILDIPPNGSVDYVVCSSKHLQSQASQSQSKILEIIAFPSNKCVGQIQVADLSQIKY 204

  Fly   173 ---------LHAKTMIPAHDTPLAALAFSPSGTEIATASERGTVIRVFSSQDGSRLFELRRGLKR 228
                     |...::|.||..|:..:..:..||.:||.|.:||:||:||:.:|:.:.|.|||:.:
Yeast   205 NSQNPKESALLPTSIIKAHKNPIKLVRLNRQGTMVATCSVQGTLIRIFSTHNGTLIKEFRRGVDK 269

  Fly   229 CVSIVSLSFSTCAEYLVSSSNTETVHIFRL-DRSATET-----AEGHGSKQSSDDWMGYSFFR 285
             ..|..:|||.....|...||.:|:|||:: :.:.|||     :..:||.....:::....:|
Yeast   270 -ADIYEMSFSPNGSKLAVLSNKQTLHIFQIFETTNTETNTPDHSRANGSSHPLKNYIPKGLWR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18aNP_001261565.1 WD40 <15..278 CDD:225201 76/314 (24%)
WD40 23..269 CDD:295369 70/299 (23%)
WD40 repeat 143..180 CDD:293791 10/73 (14%)
WD40 repeat 186..231 CDD:293791 16/44 (36%)
WD40 repeat 232..258 CDD:293791 11/25 (44%)
HSV2NP_011739.1 WD40 <220..>298 CDD:421866 31/78 (40%)
WD40 repeat 228..267 CDD:293791 15/38 (39%)
WD40 repeat 272..298 CDD:293791 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R106
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.