DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18a and G18E

DIOPT Version :9

Sequence 1:NP_001261565.1 Gene:Atg18a / 38913 FlyBaseID:FBgn0035850 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_196134.1 Gene:G18E / 830397 AraportID:AT5G05150 Length:374 Species:Arabidopsis thaliana


Alignment Length:306 Identity:90/306 - (29%)
Similarity:159/306 - (51%) Gaps:33/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNFNQNITSLAVATSGGYSLYSL-GSVDSTLDKIYHTKSDELFLIERLFESSLVAIV------SQ 74
            |.:||..:...|.|:.|:::||. ..:..::.:..|....:  :.|.||.|:|.|.|      |:
plant    36 VAWNQVCSGFIVGTNHGFNVYSCKPMIKKSISRAPHESGFK--VAEMLFLSNLFAFVGNGYNNSE 98

  Fly    75 RAPRKLKVCHFKKQSEICNYSYANTILAVKLNRERLIVCLEESLYIHNIQDMKVVHTIRDTPCNP 139
            ..|.|:.|....:...:...::.:.::||||.||.::|.|::::|::...::||...| :|..||
plant    99 YPPNKVFVWDDYRNCCLSELTFKSEVIAVKLAREHVVVVLKQNIYVYTFNNLKVDRVI-ETLMNP 162

  Fly   140 QGLCALSSSSEHCYLAYPGSVTAGEVQIFDAINLHAKTMIPAHDTPLAALAFSPSGTEIATASER 204
            :|||.::.......||.|| ...|:||:.| :..:....|.|||:.:|.:..:..|:.:||||.:
plant   163 KGLCCVTHVESKAVLACPG-FHPGQVQVHD-LRWNVIKFIKAHDSAIACMTLTLDGSLLATASTK 225

  Fly   205 GTVIRVFSSQDGSRLFELRRGLKRCVSIVSLSFSTCAEYLVSSSNTETVHIFRLDRSATETAEGH 269
            ||:||:|::.||:.|.|.|||::| ..|.:::.|:..:::.:||...|:|:|||.....      
plant   226 GTLIRIFNAVDGTLLQEFRRGVER-AEIYNVAISSNLKWVAASSEKGTLHVFRLRPDIL------ 283

  Fly   270 GSKQSSDDWMGYSFFRFLSKTVTSYLPTQVTDVFSQGRAFASVTLP 315
                |.|.....||.|.:   :..||       :...|:||..:||
plant   284 ----SFDPASSSSFIRVI---LPKYL-------YENERSFAQFSLP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18aNP_001261565.1 WD40 <15..278 CDD:225201 80/267 (30%)
WD40 23..269 CDD:295369 75/252 (30%)
WD40 repeat 143..180 CDD:293791 9/36 (25%)
WD40 repeat 186..231 CDD:293791 19/44 (43%)
WD40 repeat 232..258 CDD:293791 7/25 (28%)
G18ENP_196134.1 WD40 <102..279 CDD:295369 59/180 (33%)
WD40 repeat 165..201 CDD:293791 10/37 (27%)
WD40 <166..>279 CDD:225201 40/115 (35%)
WD40 repeat 207..244 CDD:293791 15/36 (42%)
WD40 repeat 252..289 CDD:293791 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54442
OrthoDB 1 1.010 - - D1216824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.