DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18a and Wdr45

DIOPT Version :9

Sequence 1:NP_001261565.1 Gene:Atg18a / 38913 FlyBaseID:FBgn0035850 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001277721.1 Gene:Wdr45 / 54636 MGIID:1859606 Length:360 Species:Mus musculus


Alignment Length:390 Identity:98/390 - (25%)
Similarity:174/390 - (44%) Gaps:69/390 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GEVFVNFNQNITSLAVATSGGYSLYSLGSVDSTLDK--IYHTKSDELFLIERLFESSLVAIVSQR 75
            |...::|||:.:....|...|..:|   :|:..::|  :.|.:...:.|:|.|..|:|:|:|...
Mouse     8 GVTSLHFNQDQSCFCCAMETGVRIY---NVEPLMEKGHLDHEQVGSVGLVEMLHRSNLLALVGGG 69

  Fly    76 APRKLKVCHF-----------KKQSEICNYSYANTILAVKLNRERLIVCLEESLYIHNIQDMKVV 129
            :..|......           .|...:..:::...:|||::..:::::.|...:|:::..|....
Mouse    70 SSPKFSEISVLIWDDAREGKDSKDKLVLEFTFTKPVLAVRMRHDKIVIVLRNRIYVYSFPDSPRK 134

  Fly   130 HTIRDTPCNPQGLCALSSSSEHCYLAYPGSVTAGEVQIFDAINLHAKT-----MIPAHDTPLAAL 189
            ....||..||:|||.|..|.|...|.:||. ..|.:|:.|..:....|     .|.||.:.:|.:
Mouse   135 LFEFDTRDNPKGLCDLCPSLEKQLLVFPGH-KCGSLQLVDLASTKPGTSSAPFTINAHQSDVACV 198

  Fly   190 AFSPSGTEIATASERGTVIRVFSSQDGSRLFELRRGLKRCVSIVSLSFSTCAEYLVSSSNTETVH 254
            :.:..||.:|:||::||:||:|.:|...:|.|||||... .::..::||..:.:|.:||:..|||
Mouse   199 SLNQPGTVVASASQKGTLIRLFDTQSKEKLVELRRGTDP-ATLYCINFSHDSSFLCASSDKGTVH 262

  Fly   255 IF-----RLDRSATETAEGHGSKQSSDDWMGYSFFRFLSKTVTSYLPTQVTDVFSQGRAFASVTL 314
            ||     ||:|.:.....|.                 :...:..|:.:|        .:.||.|:
Mouse   263 IFALKDTRLNRRSALARVGK-----------------VGPMIGQYVDSQ--------WSLASFTV 302

  Fly   315 PEAGVRRMCAIA-TIQKQLRLLIA-SQDGYLYVYSIPTVEGAECQLIKRHDLRLEDHYAMDIKVD 377
            | |....:||.. ...|.:..:|| ..||..:.| :.|.:| .|           :..|.|:.:|
Mouse   303 P-AESACICAFGRNTSKNVNSVIAICVDGTFHKY-VFTPDG-NC-----------NREAFDVYLD 353

  Fly   378  377
            Mouse   354  353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18aNP_001261565.1 WD40 <15..278 CDD:225201 76/285 (27%)
WD40 23..269 CDD:295369 72/268 (27%)
WD40 repeat 143..180 CDD:293791 11/41 (27%)
WD40 repeat 186..231 CDD:293791 18/44 (41%)
WD40 repeat 232..258 CDD:293791 10/30 (33%)
Wdr45NP_001277721.1 WD 1 4..42 9/36 (25%)
WD40 <187..>274 CDD:392136 33/87 (38%)
WD 2 190..230 15/39 (38%)
WD40 repeat 196..232 CDD:293791 14/35 (40%)
WD 3 235..274 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54442
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R106
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.