DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18a and wdr45b

DIOPT Version :9

Sequence 1:NP_001261565.1 Gene:Atg18a / 38913 FlyBaseID:FBgn0035850 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001008184.1 Gene:wdr45b / 493546 XenbaseID:XB-GENE-1009828 Length:344 Species:Xenopus tropicalis


Alignment Length:362 Identity:105/362 - (29%)
Similarity:168/362 - (46%) Gaps:59/362 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSLLGRTDVDAGEVFVNFNQNITSLAVATSGGYSLYSLGSVDSTLDKIYHTKSDELFL------I 60
            |:||.......|.::..|||:....|.....|:.:|:...:..        |..:.||      :
 Frog     1 MNLLPSNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKE--------KEKQEFLEGGVGYV 57

  Fly    61 ERLFESSLVAIVS-----QRAPRKLKVCHFKKQSEICNYSYANTILAVKLNRERLIVCLEESL-- 118
            |.||..:.:|:|.     :..|.|:.:....|:..:....::..:.||||.|:|::|.|:..:  
 Frog    58 EMLFRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKV 122

  Fly   119 --YIHNIQDMKVVHTIRDTPC-NPQGLCALSSSSEHCYLAYPGSVTAGEVQIFDAINLHAKTM-I 179
              :.||...:.|..|     | ||:|||.|..:|.:..||:||:.| |.|||.|..:.....: |
 Frog   123 FTFTHNPHQLHVFET-----CYNPKGLCVLCPNSNNSLLAFPGAHT-GHVQIVDLASTEKPPVDI 181

  Fly   180 PAHDTPLAALAFSPSGTEIATASERGTVIRVFSSQDGSRLFELRRGLKRCVSIVSLSFSTCAEYL 244
            |||:..|:.:|.:..||.||||||:||:||:|.:..|..:.||||| .:..:|..::|:..|..:
 Frog   182 PAHEGILSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRG-SQAANIYCINFNEDASLI 245

  Fly   245 VSSSNTETVHIFRLDRSATETAEGHGSKQSSDDWMGYSFFRFLSKTVTSYLPTQVTDVFSQGRAF 309
            ..||:..|||||..:       :...:|||             |....|:||    ..||...:|
 Frog   246 CVSSDHGTVHIFAAE-------DPKRNKQS-------------SLASASFLP----KYFSSKWSF 286

  Fly   310 ASVTLPEAGVRRMCAIATIQKQLRLLIASQDGYLYVY 346
            :...:| :|...:||..|....:..:.|  ||..|.:
 Frog   287 SKFQVP-SGSPCVCAFGTEPNSVIAICA--DGSYYKF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18aNP_001261565.1 WD40 <15..278 CDD:225201 85/279 (30%)
WD40 23..269 CDD:295369 79/262 (30%)
WD40 repeat 143..180 CDD:293791 13/37 (35%)
WD40 repeat 186..231 CDD:293791 21/44 (48%)
WD40 repeat 232..258 CDD:293791 10/25 (40%)
wdr45bNP_001008184.1 WD40 repeat 58..98 CDD:293791 8/39 (21%)
WD40 <80..258 CDD:392136 66/184 (36%)
WD40 repeat 102..126 CDD:293791 8/23 (35%)
WD40 repeat 145..183 CDD:293791 14/38 (37%)
WD 1 183..223 18/39 (46%)
WD40 repeat 188..225 CDD:293791 17/36 (47%)
WD 2 228..267 10/45 (22%)
WD40 repeat 234..267 CDD:293791 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54442
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R106
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.