DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg18a and epg-6

DIOPT Version :9

Sequence 1:NP_001261565.1 Gene:Atg18a / 38913 FlyBaseID:FBgn0035850 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_871659.1 Gene:epg-6 / 189705 WormBaseID:WBGene00012641 Length:388 Species:Caenorhabditis elegans


Alignment Length:274 Identity:79/274 - (28%)
Similarity:134/274 - (48%) Gaps:32/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TSLAVATSGGYSLYSLGSVDSTLDKIYHTKSDELFLIERLFESSLVAIVSQRAPRK--------L 80
            ::.|:|...|:.:|.|..:...:.|.|..|...:.|:::...|..:..||..|..:        .
 Worm    46 SAFAIADKDGFKMYQLNPLHFRMYKDYVIKVGPVRLVKQDGNSRRIIYVSALAGGRFAQNNLMIF 110

  Fly    81 KVCHFKKQSEICNYSYANTILAVKLNRERLIVCLEESLYIHNI-QDMKVVHTIRDTPCNPQGLCA 144
            .|...::..||...|....|..:.::..||:......:::... .|:|.:.: .|...||:|:.|
 Worm   111 DVARNEEYFEITTPSRYGPITNIHVSPNRLVALNPNRMFVWTYPDDIKQIRS-EDIRSNPKGISA 174

  Fly   145 LS--SSSEHCYLAYPGSVTAGEVQIFDAINLHAKT--------MIPAHDTPLAALAFSPSGTEIA 199
            :|  .::..|||||||..| |.|||   ::|:|.|        :|.||.|.:|.:|.:..||.:|
 Worm   175 MSYDPTTAACYLAYPGFKT-GSVQI---MHLNALTARESKSPIVIEAHLTDIAQVALNCQGTLVA 235

  Fly   200 TASERGTVIRVFSSQDGSRLFELRRGLKRCVSIVSLSFSTCAEYLVSSSNTETVHIFRL------ 258
            |.|.:|||||||.::....|:|||||..: ..:..::||.|:.||..:|:..|:|:|.:      
 Worm   236 TGSTKGTVIRVFDARTKGPLYELRRGTVQ-AHLQCMAFSPCSSYLAVASDKGTLHMFGIRDAEPQ 299

  Fly   259 -DRSATETAEGHGS 271
             .::..|.:.|..|
 Worm   300 KKKNVLERSRGSSS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg18aNP_001261565.1 WD40 <15..278 CDD:225201 79/274 (29%)
WD40 23..269 CDD:295369 77/270 (29%)
WD40 repeat 143..180 CDD:293791 17/46 (37%)
WD40 repeat 186..231 CDD:293791 20/44 (45%)
WD40 repeat 232..258 CDD:293791 9/25 (36%)
epg-6NP_871659.1 WD40 9..>320 CDD:225201 79/274 (29%)
WD40 repeat 80..124 CDD:293791 8/43 (19%)
WD40 repeat 129..170 CDD:293791 7/41 (17%)
WD40 repeat 173..216 CDD:293791 17/46 (37%)
WD40 repeat 222..259 CDD:293791 16/36 (44%)
WD40 repeat 267..306 CDD:293791 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54442
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R106
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.