DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-117

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001294719.1 Gene:nhr-117 / 24104436 WormBaseID:WBGene00003707 Length:477 Species:Caenorhabditis elegans


Alignment Length:322 Identity:68/322 - (21%)
Similarity:114/322 - (35%) Gaps:79/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 DELRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCP------------ANNECEINK 173
            |::...|.:|.....|:|:|...|.||.|||:|         |.            .:..|:.||
 Worm    28 DQVLEKCQICYQPGHGYHFGAFICRACAAFFRR---------CHFSLALDQRKCRLLSGSCQPNK 83

  Fly   174 RRRKACQACRFQKCLLMGMLKEGVRLDR--VRGGRQKYRRNPVSNSYQ---TMQLLYQSNTTSLC 233
            ..|..|:.|||.|||.:||....::.||  .:......:...|:....   ::.:.:.||...: 
 Worm    84 NGRWFCKKCRFDKCLELGMTTTNIQYDRDAFKSSASFLKNKSVAKRVADRVSVPMQFSSNQRHV- 147

  Fly   234 DVKILEVLNSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNNNDP 298
               |..|.|.:       ||||..:.....|.||............|.:..|...||...:.|..
 Worm   148 ---IYNVKNVF-------QTPPTALGKAGRTLDETDQRILCQNTVESALGINPIMIFTYADENKQ 202

  Fly   299 NEILSVLSDIYDKELVSVI------------------------GWAKQ--IPGFIDLPLNDQMKL 337
            ...:.: |.:.||.|.|::                        .|.::  :...:.|..||.:..
 Worm   203 FPFIDI-SQLVDKALSSILTPISVRKIKKMSNLEQLTQGLDEFQWTQKESVSQIVRLSANDHLND 266

  Fly   338 LQV---SWAEILTLQLTFRSLPFNGKLCFATDVWMD----EHLA--------KECGYTEFYY 384
            .|.   :.|:.|:.....|:|....|:.....:|.:    |.:|        ::||..:|.:
 Worm   267 FQTYMCAAAKWLSYSDRIRNLDDELKIQILQCIWFNWGRLERIATTAKMRNKRKCGKKQFVF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 30/109 (28%)
NR_LBD 237..493 CDD:299703 36/189 (19%)
nhr-117NP_001294719.1 ZnF_C4 33..103 CDD:197701 25/78 (32%)
Hormone_recep 248..453 CDD:278530 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.