DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-237

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_503460.1 Gene:nhr-237 / 189970 WormBaseID:WBGene00021610 Length:345 Species:Caenorhabditis elegans


Alignment Length:386 Identity:83/386 - (21%)
Similarity:140/386 - (36%) Gaps:126/386 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 RLCLVCGDVASGFHYGVASCEACKAFFKRTI-QGNIEYTCPANNECEI-NKRRRKACQACRFQKC 187
            ::|.|||:.|...|:|..||.||.|||:|.: .|....:...:..|:: |:..|:.|..||::||
 Worm     8 QICRVCGECADAVHFGALSCRACAAFFRRKVAAGKPLSSSRCSGSCKLENQVLRRLCAKCRYEKC 72

  Fly   188 LLMGMLKEGV--------------RLDRVRGGRQKYR-----------RNPVSNSYQTM------ 221
            :.:||....|              .||:::...::.:           ..|....||.|      
 Worm    73 VQVGMRTSAVLSRLAVKSEPEFESLLDQIKLAYERLQMARKEAFHTEGHIPKMIKYQEMHKMCSF 137

  Fly   222 --QLLYQSNTTSLCDVKILEVLNSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKLESS-VVT 283
              ||:.|..|:         :..|..|.:.:.:....:..|......:.|..|    :||. :|.
 Worm   138 DLQLVSQHFTS---------IFQSLTPISEAQKVTLGEYFTVPFVLLDGSYRS----VESDYIVF 189

  Fly   284 PNGTCI--------FQNNNNNDP---NEILSVLSD---IYDKELVSVIGWAKQIPGFIDLPLNDQ 334
            |||..:        :||.:..|.   :.:.|:|..   ::.:.|     |             :|
 Worm   190 PNGDYVDAQNIDAFYQNPDEKDESIGSSVASILEPYWRLHHQTL-----W-------------EQ 236

  Fly   335 MKLLQVSWAEILTLQ-LTFRSLPFNGKLCFATDVWMDEHLAKECGYTEFYYHCVQIAQRME-RIS 397
            ||.::.|..|.|.|. ..|......|:             ::||     ...|.|:..|:. .:|
 Worm   237 MKKVKPSLIEFLVLSAFIFWDFGLQGQ-------------SEEC-----IKVCNQLRARVNAELS 283

  Fly   398 PRREEYYLLKALLLANCDILLDDQSSLRAFRDTILNSLNDVVYLL---RHSSAVSHQQQLL 455
            ...:.:|..             ...|||         :.:|||||   :.|.|:.|..:.|
 Worm   284 TYEKTFYTA-------------GDYSLR---------VAEVVYLLQSVQKSLAIMHSCKTL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 30/118 (25%)
NR_LBD 237..493 CDD:299703 46/239 (19%)
nhr-237NP_503460.1 ZnF_C4 9..80 CDD:197701 26/70 (37%)
Hormone_recep 119..311 CDD:278530 50/262 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.