DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-230

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_507681.2 Gene:nhr-230 / 189442 WormBaseID:WBGene00012446 Length:414 Species:Caenorhabditis elegans


Alignment Length:267 Identity:60/267 - (22%)
Similarity:98/267 - (36%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ASAGAGSGSVRDELRRLCLVCGDVASGFHYGVASCEACKAFFKR------TIQGNIEYTCPANNE 168
            ||....|.....||  :|.||...|.|.|:|..:|.||.|||:|      |::     .|.....
 Worm     5 ASTSILSQEESSEL--ICAVCSQPARGRHFGAVACRACAAFFRRADAAKTTVK-----PCKKGGN 62

  Fly   169 CE--INKRRRKACQACRFQKCLLMGMLKEGVRLDRVRGGRQKYRRNPVS----NSYQTMQ----- 222
            |:  :|......|:.||.|||..:||.....:.|          |:|:|    |...:|:     
 Worm    63 CQNLLNNNGWFDCKFCRLQKCYEIGMNSANFQFD----------RDPISTKLTNVPNSMEGFLGR 117

  Fly   223 ---LLYQSNTTSLCDVKILE----------VLNSYEPDAL----SVQTPPPQVHTTSITNDEASS 270
               :::.......|:..:::          :|.......|    ::|.....:....|.:|  ||
 Worm   118 PHCVIFVDPEVVRCEKDLIDCTDLLRKAGRILKEGSESPLYTKSNLQKLAEALQKIDICHD--SS 180

  Fly   271 SSGSIKLESSVVTPNGTCIFQNNNNNDPNEILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQM 335
            .|..:||    ||..|           ..|:.|    .::::.:....|......|.||....::
 Worm   181 PSQPVKL----VTKYG-----------KEEVFS----FFEQDFLKATRWFTYFDEFQDLDQEQKL 226

  Fly   336 KLLQVSW 342
            :|:|..|
 Worm   227 ELIQAIW 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 32/107 (30%)
NR_LBD 237..493 CDD:299703 22/120 (18%)
nhr-230NP_507681.2 NR_DBD_like 20..98 CDD:295381 27/92 (29%)
Hormone_recep 181..391 CDD:278530 15/72 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.