DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-135

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_504798.2 Gene:nhr-135 / 189066 WormBaseID:WBGene00003725 Length:362 Species:Caenorhabditis elegans


Alignment Length:323 Identity:76/323 - (23%)
Similarity:115/323 - (35%) Gaps:95/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVAS--CEACKAFFKR-TIQGNIEYTCPANNECEINKRRRKACQACRFQKCL 188
            |.||...|:..|:|..|  |.||.|||:| .:.......|..:..|.|:.:..|.|:.||.::|:
 Worm     6 CFVCNSPANECHFGSRSQICRACSAFFRRYVLSPKSAIKCRKDKSCRIHYKDPKICRFCRMERCV 70

  Fly   189 LMGMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKILEVLNSYEPDALSVQT 253
            |.||     :...|:..|:||..:            ...:.||.|...     :.|..:..|...
 Worm    71 LAGM-----K
TTAVQPPREKYSED------------RGDSETSSCYSS-----SPYTHEVQSCSR 113

  Fly   254 PPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNN---NNNDPNEILSVLSDIYDKELVS 315
            ..|::|..|:......|..   |||           |||.   .:.:..|::.:|..  |..|||
 Worm   114 DIPRLHRLSVHFKNLESVR---KLE-----------FQNQEPPKSRNMVELIEILKK--DMRLVS 162

  Fly   316 VIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLTFRSLPFNGKLCFATDVWMDEHLAKECGYT 380
            .         |||                        .:.|..|||         .||.|:..:.
 Worm   163 T---------FID------------------------GAYPEIGKL---------GHLEKKQVFL 185

  Fly   381 EFYYHCVQIAQRMERISPRREEYYLLKALLLANCDILLDDQSSLRAFRDTILNSLNDVVYLLR 443
            .|:...:.:......||..|:|      ::|.|.|...:|   |.||..||.....:.|:|.:
 Worm   186 NFFIKYMLVEPPFLSISAGRKE------MMLPNGDHYDED---LGAFYSTINVKKEEAVHLFK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 29/92 (32%)
NR_LBD 237..493 CDD:299703 44/210 (21%)
nhr-135NP_504798.2 ZnF_C4 5..75 CDD:197701 25/73 (34%)
Hormone_recep 136..335 CDD:278530 35/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.