DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-218

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_507103.2 Gene:nhr-218 / 188479 WormBaseID:WBGene00011750 Length:391 Species:Caenorhabditis elegans


Alignment Length:416 Identity:80/416 - (19%)
Similarity:151/416 - (36%) Gaps:118/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPA-NNECEINKRRRKACQACRFQKCLLM 190
            |.:|...:.|.::.|.:|.||.|||:|::...:.|.|.. .|:|.|:...|..|:.|||||||.|
 Worm    20 CQICTYQSHGVNFNVMTCRACAAFFRRSLVCGMRYHCKTRKNDCRIDSTERHFCRLCRFQKCLQM 84

  Fly   191 GMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKILEVLNSYEPDALSVQTPP 255
            ||..|.:          :..|:|:|:::..                     .|.||:...:..|.
 Worm    85 GMKAE
KI----------QQNRDPISSTFPG---------------------TSTEPELSEIVDPE 118

  Fly   256 PQ----VHTT---------------SITNDEASSSSGSIKLESSVVTPN---------GTCIFQN 292
            .:    .|.|               ||:.:.:.|....::....::|.:         ....|||
 Worm   119 NEKSYIFHGTLYGFKSLLAEVRYIFSISRNYSDSPLTDLENGFKLITRHQKRRYIDIEDRINFQN 183

  Fly   293 NNNNDPNEILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQV-----SWAEILTLQLTF 352
                        |:|.....:.:...|......|..|...:.:.:|:.     ||.|:|::.:..
 Worm   184 ------------LTDFRLGHIKNCATWLTHSSFFQSLTETENLLILKSTWHVWSWLELLSVSVEI 236

  Fly   353 RSLPFNGKLCFATDVWMDEHLAKECGYTEFY--------------------YHCV--QIAQRMER 395
                |..::|....|::.|.:|.:......|                    :|.:  .:|::::.
 Worm   237 ----FGNQVCEEKIVFLSEKIAVDIVKVFRYILKPLNKQEKRKVEKELNPIFHILFDDVARKLQN 297

  Fly   396 ISPRREEY-YLLKALL------LANCDILLDDQSSLRAFRDTILNSLNDVVYLLRHSSAV----- 448
            :.|...|. |:|..|:      :.|.|.|...:.........:.|...:.::|.:::..|     
 Worm   298 LKPSSLEINYMLWQLVWFVAEKVLNEDNLRHGEQYTNQLASDLHNHYKNDLHLEQYAQRVLKMMA 362

  Fly   449 ---SHQQQLLLLLPSLRQADDILRRF 471
               |.|:.|:.:...:..||:....|
 Worm   363 IVKSLQKHLMNIHKIIDYADNFCNLF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 32/90 (36%)
NR_LBD 237..493 CDD:299703 48/305 (16%)
nhr-218NP_507103.2 ZnF_C4 19..89 CDD:197701 28/68 (41%)
Hormone_recep 177..376 CDD:278530 35/214 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.