DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-216

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001343620.1 Gene:nhr-216 / 188325 WormBaseID:WBGene00020385 Length:490 Species:Caenorhabditis elegans


Alignment Length:330 Identity:74/330 - (22%)
Similarity:133/330 - (40%) Gaps:70/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPANNE-CEINKRRRKACQACRFQKC 187
            ::.|.||...|.|.|:||.:|..|.|||:|.:..:::|||.:|.: |.::.|.|..|:.||::||
 Worm    58 KQKCRVCNLEAHGMHFGVQTCRPCAAFFRRIVVLDLKYTCVSNTQKCNVDGRGRNVCRDCRYKKC 122

  Fly   188 LLMGMLKEGVRLDRVR------------GGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKILEV 240
            :.:||..:.|:.:|..            .||.|.:||       .|.:|                
 Worm   123 IAVGMTTDNVQYNRDSHNNKNSSGSGGGRGRGKNKRN-------VMMML---------------- 164

  Fly   241 LNSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNNNDPNEILSVL 305
              :.|.:|....|..|   ..||..||:..|.||    ||  |.....:..:....|..|:..::
 Worm   165 --TDEEEAAGSSTVKP---GGSIKGDESFCSDGS----SS--TRGNPQLDPDAERRDDEEMDKII 218

  Fly   306 SDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLT-FRSLPFNG---KLCFATD 366
            ||:  |.|            |::....:.:....::..:.||..|. :|....:.   |.|...:
 Worm   219 SDL--KHL------------FVEYSPPEMINQCSINQLQRLTHSLVLYRQNQQSANQIKFCDTIN 269

  Fly   367 VWMD--EHLAKECGYTEFYYHCVQIAQRM---ERISPRREEYYLLKALLLANCDILLDDQSSLRA 426
            .:.|  .||.::......:..||....::   ::|...:..:.:...|..|...:.:..:.|:..
 Worm   270 AFTDGKAHLQRKSEKFSKWVKCVDFFDKLSDEQKIDTVKMSFTVFDRLERAQMSVKIFGEKSITE 334

  Fly   427 FRDTI 431
            .:.|:
 Worm   335 KKTTL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 35/105 (33%)
NR_LBD 237..493 CDD:299703 37/204 (18%)
nhr-216NP_001343620.1 ZnF_C4 60..130 CDD:197701 28/69 (41%)
Hormone_recep 287..474 CDD:306586 7/53 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.