DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-130

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_503216.1 Gene:nhr-130 / 187965 WormBaseID:WBGene00003720 Length:440 Species:Caenorhabditis elegans


Alignment Length:474 Identity:95/474 - (20%)
Similarity:157/474 - (33%) Gaps:184/474 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTIQG-NIEYTCPANNECEINKRRRKACQACRFQKCLLM 190
            |.||...|.|.|:|..||.||.|||:|...| ...|.|...|.|:|.:..|..|:.||..:|..:
 Worm    37 CQVCALPAHGNHFGAISCRACAAFFRRACTGTKTTYKCKKQNNCDIWENGRYKCKKCRLDRCNEV 101

  Fly   191 GMLKEGVRLDR-VRGGRQKYRRNPVSNSY----------QTMQ--------------LLYQSNTT 230
            ||.....:.|| :....:||   |.|.::          :|::              .:|..:..
 Worm   102 GMDPGRFQFDRDLISATEKY---PNSKNFRRTFGMSRLPETIEHFLGRPHFIIFLERHIYSHSEK 163

  Fly   231 SLCDV--------KILEV--------LNSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKLES 279
            :..|:        |:||:        .|:.|..||.:          ::..|:.:.|.     :.
 Worm   164 NFVDLQHLIAKASKLLELGSEKPLIARNNLEKLALGL----------NLVRDQPAGSH-----DV 213

  Fly   280 SVVTPNGTCIFQNNNNNDPNEILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSW-- 342
            .:||..|           .:|.|:    .::.:.::|..|......|..||.|.|:.||:..|  
 Worm   214 QLVTKLG-----------KDEALT----FWETDFLTVAKWLTYFDDFQLLPHNQQILLLKSVWHV 263

  Fly   343 ---AEILTLQLTFR----------SLPFNG--------------------KLCF----------- 363
               .|.|.|..|.|          .|.:|.                    :|||           
 Worm   264 WNRLEKLALTATSRRQNVCEQKQLMLTYNSVCNPKTIELDYSWFTKYPKEQLCFFFDEMEDYMLT 328

  Fly   364 ----------ATDVWMDEHLAKECGYTEFYY-------HCVQIAQR-MERISPRREEYYLLKALL 410
                      .||:.:...|.:.|    |:|       ..:::.:: .|.::....:||      
 Worm   329 SALDPLTSLEPTDIELTYMLCQLC----FHYAGKRYGGEILEVTEKFQENLADNLHDYY------ 383

  Fly   411 LANCDILLDDQSSLRAFRDTILNSLNDVVYLLRHSSAVSHQQQLLLLLPSLRQADDILRRFWRGI 475
                                 :|.||...|..|.:.        :|.:.:|.|.|     .|...
 Worm   384 ---------------------VNELNMPRYCGRLNQ--------MLKINNLIQQD-----IWEKR 414

  Fly   476 ARDEVITMKKLF-LEMLEP 493
            |:.|:..:..:| :|...|
 Worm   415 AKHELAKVFDIFCIEFSHP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 34/91 (37%)
NR_LBD 237..493 CDD:299703 56/328 (17%)
nhr-130NP_503216.1 ZnF_C4 36..105 CDD:197701 28/67 (42%)
Hormone_recep 210..416 CDD:278530 45/269 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.