DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-132

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001379669.1 Gene:nhr-132 / 187822 WormBaseID:WBGene00003722 Length:400 Species:Caenorhabditis elegans


Alignment Length:278 Identity:71/278 - (25%)
Similarity:113/278 - (40%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTI------QGNIEYTCPANNECEINKRRRKACQACRFQ 185
            |.|||..:.|||:||.||.||.|||:||.      |.|    |...::|: |...:..|:.||.:
 Worm     8 CEVCGLESQGFHFGVLSCRACSAFFRRTATVPKWHQKN----CQKPSKCK-NGEGQYHCKPCRLK 67

  Fly   186 KCLLMGMLKEGVRLDRVRGGRQKYRRNPVSNSYQ----------------TMQLLYQSNTTSLCD 234
            :|:.:||..|..:.|| .|...|.::..:..|::                :.|:   ||..:|.|
 Worm    68 RCIAVGMNTENFQFDR-DGLVAKLKKPKLPKSFEMFVGRPEYVLFCTPGTSAQI---SNPKTLID 128

  Fly   235 VKILEVLNSYEPDALSVQTPPPQVHTTSITNDEASS-SSGSIKLESSVVTPNGTCIFQNNNNNDP 298
            |..|  :|.    |.:|....|::  ..|..|:... :.|...||::          ..|..:.|
 Worm   129 VSGL--VNK----ASNVLLTGPEI--PIIARDQLHKLAIGFSFLENT----------STNMKDFP 175

  Fly   299 NEILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSW------AEILTLQLTFRS--L 355
            :.....:..|::...::|..|......|..|....||.||...|      .::|...:..|.  .
 Worm   176 HSSKEDVLKIWEFYFLTVARWLTYFDEFQKLDHKIQMTLLLAIWHVWGRLDKLLATAINRRRGLC 240

  Fly   356 PFNGKLCFATDVWMD-EH 372
            |....|..:..|::| ||
 Worm   241 PTKNLLTLSNGVFIDMEH 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 34/95 (36%)
NR_LBD 237..493 CDD:299703 30/146 (21%)
nhr-132NP_001379669.1 ZnF_C4 8..77 CDD:197701 29/73 (40%)
Hormone_recep 167..381 CDD:395054 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.