DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-142

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001263836.1 Gene:nhr-142 / 185740 WormBaseID:WBGene00018430 Length:441 Species:Caenorhabditis elegans


Alignment Length:413 Identity:91/413 - (22%)
Similarity:173/413 - (41%) Gaps:88/413 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTC-PANNECEINKRRRKACQACRFQKCLLM 190
            |.||...|.|.|:||.||.||.|||:|::..:.:|:| .|:..|.|:|..|..|:.||::|||.:
 Worm    50 CRVCAHTAHGVHFGVLSCRACAAFFRRSVVMDKKYSCRKASQGCRIDKSERYLCRLCRYKKCLQL 114

  Fly   191 GMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKILEVLNSYEPDALS--VQT 253
            ||..:.|          ::.|:.:|::.:..    ||......||   :..:.:.|.:..  :..
 Worm   115 GMTADNV----------QWNRDMISSTDRKR----QSEEDDATDV---DAYSDWSPGSKKSCLDA 162

  Fly   254 PP--------PQVHTTSI-----TNDEASSSSGSI-KLESSVVTPNGTCIFQNNNNNDPNEILSV 304
            ||        .::|.|.:     .:|....|:.:: |::.::         :.:..|...:...:
 Worm   163 PPLYDLSRTLNKIHKTFMEFKIPVDDPVYQSTSTLGKMDWAL---------RRHRKNKKMQNFRI 218

  Fly   305 LSDIYDKELVSVIG--WAKQI------PGFIDLPLNDQMKLLQVSWA-----EILTLQL-TFRSL 355
            ::.|...:||.:.|  ..||.      ..|.:|.|.::..:.::.|.     |.||:.| .|...
 Worm   219 INTIRLDQLVDMWGMEMTKQAEFMMHSEEFRELSLEEKFSIFKLVWQVSQRFEKLTMSLEIFGKR 283

  Fly   356 PFNGKLCFAT--------DVWMDEHLAKECGYTE------FYYHCVQ----IAQRMERISPRREE 402
            ....|:...:        ||.:|  |:|...||.      |.:.|.|    :|:.:..:.|...|
 Worm   284 AIEEKILITSNSTAIRMEDVEID--LSKITDYTSLELRKMFQHVCSQMYEEVARPLMELDPSTIE 346

  Fly   403 Y-YLLKALL--LANCDILLDDQSSLRAFRDTILNSLNDVVYLLRHSSAVSHQQQLLLLLPSLRQA 464
            . |:|..::  :|...:..|...:...|...|.:.|:.  |.|:.....::..:|:.|:..:...
 Worm   347 ISYMLCQIIWHIAGKTLQGDILDAGEKFIGKIADDLHQ--YYLKEYKMSNYAGRLIKLMTVVNSL 409

  Fly   465 DDILRRFWRGIARDEVITMKKLF 487
            ..|      .:.|.:::.:.|:|
 Worm   410 QRI------HLDRLKIMELAKIF 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 34/90 (38%)
NR_LBD 237..493 CDD:299703 53/302 (18%)
nhr-142NP_001263836.1 ZnF_C4 50..119 CDD:197701 31/68 (46%)
Hormone_recep 212..418 CDD:278530 42/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.