DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-133

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_503602.1 Gene:nhr-133 / 185729 WormBaseID:WBGene00003723 Length:406 Species:Caenorhabditis elegans


Alignment Length:265 Identity:66/265 - (24%)
Similarity:99/265 - (37%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEY---TCPANNECEINKRRRKACQACRFQKCL 188
            |.:|...|.|.|:||.||.||.|||:|....|.:|   .|...| |..|...|  |:.||.:||.
 Worm    11 CEICEQPAHGNHFGVLSCRACAAFFRRAALQNAKYQDRVCRKGN-CIGNDLYR--CKICRLKKCC 72

  Fly   189 LMGMLKEGVRLDR--VRGGRQKYRRNPVSNSYQTMQLLYQ------------SNTTSLCDVKIL- 238
            .:||.....:.||  :....:.......|........|.:            |:|..|.||..| 
 Worm    73 EVGMNSSKFQNDRDLISSSLRPTNYTKTSAPQSLANFLGRPEFILCCEPDKASSTKRLVDVTSLV 137

  Fly   239 -EVLNSYEPDALSVQTP---PPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNNNDPN 299
             :....::.||....:|   |..:...:...:|......|.|||  :.|..|.           |
 Worm   138 DKAWAIFQEDAAYSWSPNHYPNSLEKLTFEMEEIKLKESSKKLE--IATTIGR-----------N 189

  Fly   300 EILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLTFRSLPFNGKLCFA 364
            |.|..|    ::..:....|..::|.|..|....::.:|:.||.....|.....:..|:.:....
 Worm   190 EALLFL----EQSFLGAAQWFARLPEFSMLDPQIKIDILKTSWMIWARLDKLAATADFHRQKLLG 250

  Fly   365 TDVWM 369
            .||:|
 Worm   251 NDVYM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 32/94 (34%)
NR_LBD 237..493 CDD:299703 28/138 (20%)
nhr-133NP_503602.1 NR_DBD_like 11..86 CDD:295381 30/77 (39%)
Hormone_recep 176..383 CDD:278530 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.