DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-37

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_504683.1 Gene:nhr-37 / 185727 WormBaseID:WBGene00018412 Length:417 Species:Caenorhabditis elegans


Alignment Length:424 Identity:93/424 - (21%)
Similarity:166/424 - (39%) Gaps:76/424 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTC-PANNECEINKRRRKACQACRFQKCLLM 190
            ||||...::|.|:|..:|.||.|||:|.....::|.| ..|::|.|:.|.|..|:.||..||..:
 Worm     7 CLVCKKASNGMHFGALTCRACAAFFRRATVLKLQYKCKQGNSKCNIDGRGRYVCRQCRLTKCKAI 71

  Fly   191 GMLKEGVRLD-----RVRG-----GRQKY---RRNPVSNSYQTMQLLYQSNTTSL-CDVKILEVL 241
            ||.:|.|:||     ..||     |..::   ..:|..:.|....|..:::..|. .|...|...
 Worm    72 GMNEEKVQLDYDPTYSFRGLMEDSGSDEFSTPNGSPAQSDYSPTNLSRKNSVESPGIDPNFLFTF 136

  Fly   242 NSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNNNDPNEILSVLS 306
            :...||     .|...:....:.....:|.|...|.:...:|...:.:.:...|......:|.|.
 Worm   137 SPKTPD-----KPNMVISFNDLVKKIETSFSHKTKGDDCELTTLTSALKKFRKNQKAQSQISFLD 196

  Fly   307 DIYDKELVSVIGWA-----------KQIPGFIDLPLNDQMKLLQVSWAEILTLQLTFRSLPF--- 357
            .:   ||.|.|.|.           ......:.||::.:|:|.:.||..:.|.:....|:..   
 Worm   197 KV---ELKSAIDWLNDRIYMYSCWFSSSKSLMSLPMDQKMQLFRSSWNVVRTFERLEMSVKIFEE 258

  Fly   358 ----NGKLCFATDVWM---DEHL--AKECGYTEFYYHCV----------QIAQRMERISPRREE- 402
                .|.:....|:.|   ..|:  |.....|..|::.:          ::|:.:..:.|..|| 
 Worm   259 GVIRGGYILINDDLAMKLESTHIDFASITDLTNQYFNKLFEPFLHRYIDEVARPLLDLKPTTEEV 323

  Fly   403 -YYLLKALLLANCDILLDDQSSLRAFRDTILNSLNDVVYLLRHSSAVSHQQQLLLLLPSLRQADD 466
             :.::..:.|...|:..:.:.:....|..|.:.::  ||....:....:..:||:|:..::....
 Worm   324 VFCMVHLIGLEEGDLSHETREACEQMRAEIADQMH--VYYTNRTDIKMYSHRLLILMKLVKSMKR 386

  Fly   467 ILRRFWRGIARDEVITMKKLF-------LEMLEP 493
            |.|         |...:|:||       .|:.||
 Worm   387 ISR---------EKSKIKELFWLFDIFHAEISEP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 36/103 (35%)
NR_LBD 237..493 CDD:299703 51/297 (17%)
nhr-37NP_504683.1 ZnF_C4 7..76 CDD:197701 28/68 (41%)
Hormone_recep 189..393 CDD:278530 38/217 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.