DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-162

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_504769.1 Gene:nhr-162 / 183181 WormBaseID:WBGene00016367 Length:347 Species:Caenorhabditis elegans


Alignment Length:114 Identity:35/114 - (30%)
Similarity:52/114 - (45%) Gaps:17/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LCLVCGDVASGFHYGVASCEACKAFFKRTIQG-NIEYTCPANNECEINKRRRKACQACRFQKCLL 189
            ||.|||......|:|..||.||.|||:|.:.. .::.:|    .|:........|:.||..||:.
 Worm     2 LCQVCGAEGPEPHFGGISCRACAAFFRRYVHSRKLDISC----TCKHRLATSHPCRHCRMLKCMA 62

  Fly   190 MGMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKIL 238
            .||:|     .:|:|.|:|       |...|..|....::.||...:|:
 Worm    63 TGMVK-----CKVQGSREK-------NKITTSSLPGHISSISLLSARIV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 29/91 (32%)
NR_LBD 237..493 CDD:299703 1/2 (50%)
nhr-162NP_504769.1 ZnF_C4 2..65 CDD:197701 22/66 (33%)
Hormone_recep 121..323 CDD:278530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.