DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-112

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001024286.1 Gene:nhr-112 / 180115 WormBaseID:WBGene00003702 Length:342 Species:Caenorhabditis elegans


Alignment Length:393 Identity:78/393 - (19%)
Similarity:138/393 - (35%) Gaps:94/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LCLVCGDVASGFHYGVASCEACKAFFKRTIQG-NIEYTCPANNECEINKRRRKACQACRFQKCLL 189
            :|.:||...|..|:|..||.||.|||:|.... .:...|    .|:..:.....|::||.:||..
 Worm     1 MCKICGSSESEPHFGGTSCRACAAFFRRFYHSKKLGLKC----TCKTRQSNAHPCRSCRIRKCYE 61

  Fly   190 MGMLKEGVRLDRVRGGRQKY--------------------RRNP-----VSNSYQTMQLLYQSNT 229
            .||..|.::|.     |.|:                    |:.|     :||.::......:.|:
 Worm    62 AGMTPEKIQLT-----RDKHLNRTIKLEGPCSSLDTPITSRQTPNLYCVLSNWHELKMTREEMNS 121

  Fly   230 TSLCDVKILE----VLNSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKL-ESSVVTPNGTCI 289
            .||.:..|.|    ||...|.....|....|.|......:.:|...:...|| :...:.....|.
 Worm   122 GSLNNCNIFELTSFVLRDLELTWRMVSKAFPTVEVLEDRDRQALLRNFVPKLWQIEPILEYRECA 186

  Fly   290 --FQNNNNNDPNEILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLTF 352
              |.|....|           |:..||...|..  .|...::..::.:...:..|....|..:  
 Worm   187 EKFDNLEEED-----------YENLLVGFYGGT--FPEGKEMSKSEIVSNFRPYWDYYYTKMI-- 236

  Fly   353 RSLPFNG----KLCFATDVWM---DEHLAKECGYTEFYYHCVQIAQRMERISPRREEYYLLKALL 410
              ||.:.    :|.:...||:   |.      ||:....:|:::.:.::::        :||.|.
 Worm   237 --LPISSMGLEELEYMAIVWLAFFDN------GYSNISDNCLEMCRDIQKV--------ILKELR 285

  Fly   411 LANCDILLDDQSSLRAFRDTILNSLNDVVYLLRHSSAVSHQQQLLLLLPSLRQADDILRRFWRGI 475
            ....|         |.|.:.......:.:.::........::.|:..:..:|..||     :|.|
 Worm   286 NYQID---------RNFHENRFFVALEALQIIERGEKKFMEEMLVCEMNHIRIHDD-----FRKI 336

  Fly   476 ARD 478
            .|:
 Worm   337 IRE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 30/116 (26%)
NR_LBD 237..493 CDD:299703 44/256 (17%)
nhr-112NP_001024286.1 ZnF_C4 2..67 CDD:197701 23/68 (34%)
HOLI 138..310 CDD:214658 33/211 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.