DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-108

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_506987.1 Gene:nhr-108 / 180065 WormBaseID:WBGene00003698 Length:338 Species:Caenorhabditis elegans


Alignment Length:380 Identity:87/380 - (22%)
Similarity:139/380 - (36%) Gaps:116/380 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPANNECEINKRRRKACQACRFQKCLLMG 191
            |:|||:::....:|..||.||..||:|.|..........|..|::.|..||.||:|||||||.:|
 Worm    10 CMVCGEISYSIRFGAVSCRACAEFFRRKIVSKARIPKRCNGACDLGKYHRKTCQSCRFQKCLKIG 74

  Fly   192 MLKEGVRLDRVRGGRQKYRRNPV---SNSYQT----MQLLYQSNTTSLCDV-----KILEVLNSY 244
            ||::.|.           .|.||   |.:.||    ::..|.....|..:|     ||.:..|..
 Worm    75 M
LEKVVA-----------SRTPVNRRSENNQTILSGLEKAYDKLENSRDNVFDRKNKIPKYCNHQ 128

  Fly   245 EPDALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNN--NDPNEILSVLSD 307
            |.|.:                         .:::..:::.:....|::.::  |:.|::||. ..
 Worm   129 ELDDM-------------------------FEIDIKLISTHFIQFFESKSSLENNQNKVLST-HF 167

  Fly   308 IYDKELVSVIGWAKQIPGFIDLPLND------------------------QMKLLQVSW------ 342
            |....|:.|...|...|.:| ||.||                        ...:||..|      
 Worm   168 IIRFSLLEVAFRAFGKPTYI-LPNNDIIDVSKLDKVYQHLETGEDERGKNSQVILQRFWQMNEKT 231

  Fly   343 --AEILTLQLTFRSLPFNGKLCFATDVWMDEHLAKECGYTEFYYHCVQIAQRME-RISPRREEY- 403
              .|:..:.|......|   || |...|       :.|.......|::..|||. ::.....|| 
 Worm   232 MKTEVFPVNLDQSEFLF---LC-ALIYW-------DFGIENQSEKCLEECQRMRTQVLKELTEYE 285

  Fly   404 ---YLLKALLLANCDILLDDQSSLRAFRDT-ILNSLNDVVYLLRHSSAVSHQQQL 454
               |               .::.||..:.. ||.:|...:.:::||..:|:...|
 Worm   286 KSNY---------------PENELRVAQVIGILQALQKTLDVIQHSGYISNVYNL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 35/92 (38%)
NR_LBD 237..493 CDD:299703 46/258 (18%)
nhr-108NP_506987.1 ZnF_C4 9..75 CDD:197701 27/64 (42%)
HOLI 134..309 CDD:214658 38/202 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.