DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-42

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_504771.1 Gene:nhr-42 / 179084 WormBaseID:WBGene00003632 Length:356 Species:Caenorhabditis elegans


Alignment Length:340 Identity:84/340 - (24%)
Similarity:132/340 - (38%) Gaps:108/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RDELRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQG--NIEYTCPANNECEINKRRRKACQAC 182
            |....:.||:|||.|...|:|..||.||.|||:|.:.|  ||...|  :.:|:::...||.|.:|
 Worm     3 RQTTSQTCLICGDSADSLHFGALSCRACAAFFRRKVAGRRNIFRRC--DRQCKVDTGMRKLCASC 65

  Fly   183 RFQKCLLMGMLKEGVRLDRVRGGRQKYRRNPVS--NSYQTMQLLYQSNTTSLCDVKILEVLNSYE 245
            |:.|||.:|| :|...|.|:....|.|:::.|.  ::|:.        :||..| .:||.|.|  
 Worm    66 RYDKCLKVGM-RESAVLSRLAKKNQNYKKSIVGSPDAYEP--------STSTSD-SVLENLQS-- 118

  Fly   246 PDALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNN---NDPNEILSVLSD 307
                       ..|....|.....:.|     |:.|   :..|.::..|:   .|...::..|.:
 Worm   119 -----------AYHKLEETRKRVFNIS-----ETHV---SQCCNYKRMNDVFFEDIKLVMEHLLE 164

  Fly   308 IYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLTFRSLPFNGKLCFATDVWMDEH 372
            .:.|..:|                .:|.|||.|.:           .:||               
 Worm   165 TFKKSDIS----------------QEQEKLLCVHF-----------MVPF--------------- 187

  Fly   373 LAKECGY----TEFYYHCVQIAQRMERISPRR-EEYYLLKALLLANCDILLDD--QSSLRAFR-- 428
            :..|.||    ::.:|     ....:.|...| ||||       :|.|...|:  :|:...||  
 Worm   188 ILFEGGYKSTNSDLFY-----LPSGDFIDENRIEEYY-------SNPDDQNDNSAKSAAEVFRPY 240

  Fly   429 -----DTILNSLNDV 438
                 .|:...|:||
 Worm   241 WKLNKQTLKTHLDDV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 37/99 (37%)
NR_LBD 237..493 CDD:299703 42/219 (19%)
nhr-42NP_504771.1 ZnF_C4 9..78 CDD:197701 31/71 (44%)
HOLI 151..327 CDD:214658 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.