DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-115

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001256014.1 Gene:nhr-115 / 178708 WormBaseID:WBGene00003705 Length:391 Species:Caenorhabditis elegans


Alignment Length:269 Identity:65/269 - (24%)
Similarity:101/269 - (37%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPANNECEINKRRRKA--CQACRFQKCLL 189
            |.:||..:.|.|:|:.||.||.|||:|::  |.::   |...|..|.:.:.:  |:.||.:||:.
 Worm     8 CQICGQNSHGTHFGIVSCRACAAFFRRSV--NSKW---ARKGCLTNFKDKGSCFCKPCRLRKCVE 67

  Fly   190 MGMLKEGVRLDRVRGGRQKYRRNPVSNSYQT----MQLLYQSNTTS---LCDVK--ILEVLNSYE 245
            :||.....:.||......|:.:...|.||..    ..:...||.||   ..||:  :.||....:
 Worm    68 IGMDAS
KFQYDRDAISAIKHPKIFPSVSYYVGRPEFLMFSDSNVTSQKTFIDVQNLVFEVSRYLD 132

  Fly   246 PDALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNNNDPNEI-LSVLSDIY 309
            .   ..:||       ....::....:...||..          |...|....::| .:...||.
 Worm   133 H---GCETP-------IYAENQLKKLTLGFKLMQ----------FDYQNVKFFDKIGKAEFIDII 177

  Fly   310 DKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLTFRSLPFNGKLCFATDVWMDEHLA 374
            :...::|..|......|..|..:.|:||||..|                       .||...|  
 Worm   178 EYYFLTVAKWIAHFDEFRKLDQSLQIKLLQAIW-----------------------HVWSKIH-- 217

  Fly   375 KECGYTEFY 383
             :|..|.||
 Worm   218 -KCASTAFY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 29/91 (32%)
NR_LBD 237..493 CDD:299703 28/148 (19%)
nhr-115NP_001256014.1 ZnF_C4 7..73 CDD:197701 25/69 (36%)
Hormone_recep 160..365 CDD:278530 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.