DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-18

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_503608.2 Gene:nhr-18 / 178702 WormBaseID:WBGene00003617 Length:394 Species:Caenorhabditis elegans


Alignment Length:372 Identity:83/372 - (22%)
Similarity:129/372 - (34%) Gaps:107/372 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SGSVRDELRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIE-YTCPANNECEINKRRRKAC 179
            |||        |.||||..||.|:||.||.||.|||:|....|:| ..|| |..|..:...:..|
 Worm     8 SGS--------CEVCGDKTSGRHFGVMSCRACAAFFRRAATWNLEKRICP-NGTCHTSVNGKFNC 63

  Fly   180 QACRFQKCLLMGMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKILEVLNSY 244
            :.||.:|||.:||.....:.|          |:.:|.|     .:.||..|.|...   |.:...
 Worm    64 KQCRLKKCLDVGMDTRRFQTD----------RDLISCS-----AISQSLATFLGRP---EFILCC 110

  Fly   245 EPDALSV-QTPPPQVHTTSITNDEASSSSGSI----KLESSVVT-PNGTCIFQNNNNNDPNEILS 303
            |||..|| :|........:|..|.....:..:    .||....| .|..|:    .:|...:.:.
 Worm   111 EPDRASVLKTTIDVTRLVNIARDMLQKPTNHVLPSNSLEQLATTLDNMRCV----ESNKEVKFIE 171

  Fly   304 VLSDI-----YDKELVSVIGWAKQIPGFIDLPLNDQMKL-------------------------- 337
            ....:     :::..:.|:.|......|.:  ||:::||                          
 Worm   172 KYGKVETLKSWEQGFLRVVEWFSNFSEFRE--LNERLKLEIVKSCWFSWTRLDKLSETANKQINK 234

  Fly   338 ---------------------LQVSWAEILTL-QLTFRSLPFNGKLCFATDV------------- 367
                                 :.:||....:| ||.:.....|||..|...:             
 Worm   235 MLGKSQLMVGNGACMNMNNFEIDLSWCTNYSLEQLKYFFQTPNGKKNFQQSIQDMIDLNPSSIEV 299

  Fly   368 -WMDEHLAKECGYTEFYYHCVQIAQRMERISPRREEYYLLKALLLAN 413
             :|..||:.|......:...:...:.:.::.......|.::.|.|||
 Worm   300 SYMLLHLSLEHAGKRLHGDALDATENLVQVQANNLHKYYVEKLKLAN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 35/96 (36%)
NR_LBD 237..493 CDD:299703 40/250 (16%)
nhr-18NP_503608.2 NR_DBD_like 11..86 CDD:295381 33/85 (39%)
Hormone_recep 163..371 CDD:278530 26/186 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.