DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-56

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001033487.1 Gene:nhr-56 / 178699 WormBaseID:WBGene00003646 Length:408 Species:Caenorhabditis elegans


Alignment Length:422 Identity:93/422 - (22%)
Similarity:166/422 - (39%) Gaps:128/422 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RRLCLVCGDVASGFHYGVASCEACKAFFKRT-IQGNIEYTCPANNECEINKRRRKACQACRFQKC 187
            :.||.:||:.|.|.|:||.||.||.|||:|| :.|  |..||..| |:|:|..:..|:.||.:.|
 Worm     7 KSLCKICGNPAFGNHFGVLSCRACAAFFRRTNVDG--ETFCPIGN-CKIDKHGKFYCKKCRLRIC 68

  Fly   188 LLMGMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCD----------VKILEVLN 242
            |..||                     .:|.:|..:.|..::|:...|          .|:.:.:.
 Worm    69 LEAGM---------------------DANKFQHDRDLISTSTSESSDSSGSFSFSQRSKVPKSMA 112

  Fly   243 SY----------EPD-ALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNN- 295
            ::          ||| |..|:|   .|..|.:.| :|....|::..:.          |.:|:| 
 Worm   113 NFLGRPAFILSCEPDKASKVKT---IVDVTFLIN-QAFDIFGNVDRKR----------FSSNSNL 163

  Fly   296 -----------NDPNEILSVLSDI--------YDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVS 341
                       |:.:..||.:..:        ::::.:....|......|.:|||:.:|::|:|:
 Worm   164 GRMTKKFEDLQNEKSSNLSTIKVLGLKESMIFWEQDFLRTARWLSHFDEFQELPLSIRMQILKVA 228

  Fly   342 WA-------------EILTLQLTFRSLPFNGKLC------FATDV-WMDEHLAKECGYTEFYYHC 386
            |.             |....||. ::....||..      |..|| |...:..::..|   |..|
 Worm   229 WILWGRLDKLVKTANERKNQQLN-QNFYMIGKDVGIDIGNFEVDVSWCTNYSKEQLAY---YLDC 289

  Fly   387 VQ------IAQRMERISPRREEY-YLLKALLLANC------DILLDDQSSLRAFRDTILNSLNDV 438
            ..      |...:..:.|...|. ::|..|.||:.      |:|:        |.|.:|..:::.
 Worm   290 HHDEPFNIIVDAISDLKPSDMELNFMLLELCLAHAGKQHQGDVLM--------FTDRLLEVVSNE 346

  Fly   439 VYLLRHSSAVSHQQQLLLLLPSLRQADDILRR 470
            ::....|..:|:...   .:..:.:.::::||
 Worm   347 LHDYYQSEQISNYSS---RITKMMKINNLIRR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 33/93 (35%)
NR_LBD 237..493 CDD:299703 54/298 (18%)
nhr-56NP_001033487.1 ZnF_C4 9..76 CDD:197701 33/90 (37%)
Hormone_recep 177..390 CDD:365875 39/214 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.