DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and nhr-106

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_503219.1 Gene:nhr-106 / 178571 WormBaseID:WBGene00003696 Length:382 Species:Caenorhabditis elegans


Alignment Length:238 Identity:57/238 - (23%)
Similarity:95/238 - (39%) Gaps:57/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNI-EYTCPANNECEINKRRRKACQACRFQK 186
            ::..|.:|...|.|.|:|..:|..|.|||:|.:.... ..:|..::.|.....:...|::||.:|
 Worm     1 MQTTCEICEVPAHGIHFGAITCRGCAAFFRRAVNTKTNRKSCKYSSNCTNFTGKFPQCKSCRMRK 65

  Fly   187 CLLMGMLKEGVRLDRVRGGRQKYRRNPVSNSYQTM-----QLLYQSN---TTSLCDV-----KIL 238
            |:.|||:.|.|::           ..|:|.|.:..     .:|:.:|   |.:..||     :.|
 Worm    66 CIKMGMMPEKVKV-----------MQPISQSLEIFVSRPNLILFTNNYDKTRNYIDVSNLITRGL 119

  Fly   239 EVLNSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKLESS----VVTPNGTCIFQNNNNNDPN 299
            |:|....|..|.:          ..||.|..:|........|    |||...             
 Worm   120 EILKQGFPTPLGI----------GKTNLERMASGVEFSTAESKIVDVVTGKS------------- 161

  Fly   300 EILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSW 342
                 :|.:::.:.:|...|..::..|..||:..||:|||..|
 Worm   162 -----VSMVWEFDFISTAKWLTRLQDFCTLPMRIQMQLLQTIW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544 26/94 (28%)
NR_LBD 237..493 CDD:299703 25/110 (23%)
nhr-106NP_503219.1 ZnF_C4 4..74 CDD:197701 22/69 (32%)
Hormone_recep 150..357 CDD:278530 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.