DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERR and LOC110438504

DIOPT Version :9

Sequence 1:NP_648183.3 Gene:ERR / 38912 FlyBaseID:FBgn0035849 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_021326727.1 Gene:LOC110438504 / 110438504 -ID:- Length:161 Species:Danio rerio


Alignment Length:159 Identity:60/159 - (37%)
Similarity:89/159 - (55%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 MKLLQVSWAEILTLQLTFRSLPFNGKLCFATDVWMDEHLAKECGYTEFYYHCVQIAQRMERISPR 399
            |.|||.:|.|||.|::.|||||.:.:|.||.|..||...||..|..|.:...:|:.:|...:|..
Zfish     1 MSLLQSAWMEILVLRVAFRSLPCDDRLLFADDYIMDAEQAKCAGLLELHTAILQLVRRYRCMSLE 65

  Fly   400 REEYYLLKALLLANCDIL-LDDQSSLRAFRDTILNSLNDVVYLLRHSSAVSHQQQLLLLLPSLRQ 463
            |||:..|||:.|||.|.: ::|..:::..:|.:..:|.| ...:.||.......:|::.||.|||
Zfish    66 REEFVTLKAIALANSDSMHIEDVEAVQGLQDALHEALLD-YECVHHSEDPRRAGKLIMTLPLLRQ 129

  Fly   464 ADDILRRFWRGIARDEVITMKKLFLEMLE 492
            ......|.:..|.:|..:.|.|||||:||
Zfish   130 TSAKAVRHFCSIKQDGRVPMHKLFLELLE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERRNP_648183.3 NR_DBD_ERR 121..217 CDD:143544
NR_LBD 237..493 CDD:299703 60/159 (38%)
LOC110438504XP_021326727.1 NR_LBD <1..159 CDD:325017 60/159 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D297679at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.