DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and GRE2

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_014490.1 Gene:GRE2 / 854014 SGDID:S000005511 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:378 Identity:74/378 - (19%)
Similarity:135/378 - (35%) Gaps:128/378 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDIVNPLFI---- 178
            :.::|..||:..|:||.|:.:.::||       |..|:.|.   .||......:  ||.|.    
Yeast     3 VFVSGANGFIAQHIVDLLLKEDYKVI-------GSARSQEK---AENLTEAFGN--NPKFSMEVV 55

  Fly   179 ------------------EIDEIYHLASPASPPHYMYNPVKTIKTNTMGTIN-VLGL-------- 216
                              :|..:.|.|||     :.::...:.:...:..:| |.|:        
Yeast    56 PDISKLDAFDHVFQKHGKDIKIVLHTASP-----FCFDITDSERDLLIPAVNGVKGILHSIKKYA 115

  Fly   217 AKRVMAKVLIASTSEVYGDPTVHPQPETY----WGHVNPIGPRAC-------YDEGKRVSETLSY 270
            |..|...||.:|.:.|:.....:.:..|:    |   ||....:|       |...|:.:|..::
Yeast   116 ADSVERVVLTSSYAAVFDMAKENDKSLTFNEESW---NPATWESCQSDPVNAYCGSKKFAEKAAW 177

  Fly   271 AYAKQEKVQVR-----VARIFNTYGPRM-------HMN--------------------------D 297
            .:.::.:..|:     |..:: .:||:|       |:|                          |
Yeast   178 EFLEENRDSVKFELTAVNPVY-VFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYID 241

  Fly   298 GRVVSNFILQAL-RNETI---TVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLGNP----V 354
            .|.|:...|.|. :.|||   .:....:.|  .|.|.|:::....::..|    :.:|.|    .
Yeast   242 VRDVAKAHLVAFQKRETIGQRLIVSEARFT--MQDVLDILNEDFPVLKGN----IPVGKPGSGAT 300

  Fly   355 EQTIGEFAE--IIKKLVGGPSVIKQSKAMEDDPQRRKPDITRARQLLHWEPKV 405
            ..|:|...:  ..|||:|  ...:..|...||         .|.|:|.:|.::
Yeast   301 HNTLGATLDNKKSKKLLG--FKFRNLKETIDD---------TASQILKFEGRI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 74/378 (20%)
UGD_SDR_e 116..419 CDD:187541 74/378 (20%)
GRE2NP_014490.1 AR_SDR_e 3..318 CDD:187538 66/341 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345647
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.