DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and YGL039W

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_011476.1 Gene:YGL039W / 852844 SGDID:S000003007 Length:348 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:49/243 - (20%)
Similarity:91/243 - (37%) Gaps:76/243 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRN-----VEHWLGHENFEL-IHHDIVNPL 176
            :.::|..||:..|:||||:..|::||     .:||.:.     ::.:..:.|..: |..||..|.
Yeast     8 VFVSGATGFIALHVVDDLLKTGYKVI-----GSGRSQEKNDGLLKKFKSNPNLSMEIVEDIAAPN 67

  Fly   177 FI---------EIDEIYHLASPASPPHYMYNPVKTIKTNTM------------GTINVLGLAKRV 220
            ..         ||..:.|:|||.   |:          ||.            ||.::|...|..
Yeast    68 AFDKVFQKHGKEIKVVLHIASPV---HF----------NTTDFEKDLLIPAVNGTKSILEAIKNY 119

  Fly   221 MA----KVLIASTSEVYGDP-----TVHPQPETYWG-------HVNPIGPRACYDEGKRVSETLS 269
            .|    ||:|.|:......|     |.....|..|.       ..|.:   :.|...|:.:|..:
Yeast   120 AADTVEKVVITSSVAALASPGDMKDTSFVVNEESWNKDTWESCQANAV---SAYCGSKKFAEKTA 181

  Fly   270 YAYAKQEKVQVR-VARIFN---TYGPRMHMNDGR--------VVSNFI 305
            :.:.::.:..:: .....|   .:||::..:..|        :::|.:
Yeast   182 WDFLEENQSSIKFTLSTINPGFVFGPQLFADSLRNGINSSSAIIANLV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 49/243 (20%)
UGD_SDR_e 116..419 CDD:187541 49/243 (20%)
YGL039WNP_011476.1 AR_SDR_e 7..324 CDD:187538 49/243 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.