DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and ARI1

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_011358.3 Gene:ARI1 / 852720 SGDID:S000003125 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:71/347 - (20%)
Similarity:125/347 - (36%) Gaps:108/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILITGGAGFVGSHLVDDLMVQGHEVI-----------VVDNFFTGRKRNVEHWLGHENFELIHHD 171
            :.::|..||:..|:::||:..|:.||           ::..|....|.::|          |..|
Yeast     7 VFVSGATGFIALHIMNDLLKAGYTVIGSGRSQEKNDGLLKKFNNNPKLSME----------IVED 61

  Fly   172 IVNP-LFIEI-----DEIYHLASPASPPHY-MYNPVKTIKTNTM-GTINVLGLAKRVMA----KV 224
            |..| .|.|:     .||..:...|||.|: ..|..|.:.|..: ||.::|...|:..|    ||
Yeast    62 IAAPNAFDEVFKKHGKEIKIVLHTASPFHFETTNFEKDLLTPAVNGTKSILEAIKKYAADTVEKV 126

  Fly   225 LIASTSEVYGDPTVHPQ-----PETYWG-------HVNPIGPRACYDEGKRVSETLSYAYAKQEK 277
            ::.|::.....||...:     .|..|.       ..|.:   |.|...|:.:|..::.:.|:.|
Yeast   127 IVTSSTAALVTPTDMNKGDLVITEESWNKDTWDSCQANAV---AAYCGSKKFAEKTAWEFLKENK 188

  Fly   278 VQVR-VARIFN---TYGPRMHMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIA 338
            ..|: .....|   .:||:|           ...:|::...|..|         .||:|:...:.
Yeast   189 SSVKFTLSTINPGFVFGPQM-----------FADSLKHGINTSSG---------IVSELIHSKVG 233

  Fly   339 LMASNYTQP------------VNLGNP-------------------VEQTIGEFAEIIKKL---- 368
            ....||..|            |.:..|                   |:....||.::..|:    
Yeast   234 GEFYNYCGPFIDVRDVSKAHLVAIEKPECTGQRLVLSEGLFCCQEIVDILNEEFPQLKGKIATGE 298

  Fly   369 -VGGPSVIKQSKAMEDDPQRRK 389
             ..|||.::::....|:.:.:|
Yeast   299 PATGPSFLEKNSCKFDNSKTKK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 71/347 (20%)
UGD_SDR_e 116..419 CDD:187541 71/347 (20%)
ARI1NP_011358.3 AR_SDR_e 6..323 CDD:187538 71/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.