DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and YDR541C

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_010830.4 Gene:YDR541C / 852154 SGDID:S000002949 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:341 Identity:74/341 - (21%)
Similarity:129/341 - (37%) Gaps:79/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHWLGHENFEL-IHHDIVNP-LFIEI 180
            :|::|.:||:..|::..|:.|.::||..........:.:..:..:.|..| |..||.:| .|.::
Yeast     5 VLVSGASGFIALHILSQLLKQDYKVIGTVRSHEKEAKLLRQFQHNPNLTLEIVPDISHPNAFDKV 69

  Fly   181 -----DEIYHLASPASPPHY---MYNPVKTIKTNTMGTINVLGLAKRVMA----KVLIAS----- 228
                 .||.::...|||.||   .|.....|.. ..||.|:|...|:..|    :|::.|     
Yeast    70 LQKRGREIRYVLHTASPFHYDTTEYEKDLLIPA-LEGTKNILNSIKKYAADTVERVVVTSSCTAI 133

  Fly   229 -TSEVYGDPTVHPQPETY----WGHVNPIGPRACYDEGKRVSETLSYAYAKQE----KVQVRVAR 284
             |.....||:|....|::    |......|..| |...|:.:|..::.:.|:.    |.::....
Yeast   134 ITLAKMDDPSVVFTEESWNEATWESCQIDGINA-YFASKKFAEKAAWEFTKENEDHIKFKLTTVN 197

  Fly   285 IFNTYGPRM-------HMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMAS 342
            ....:||::       |:|....:.|.::....|.::.           .:.|..:|.....:|.
Yeast   198 PSLLFGPQLFDEDVHGHLNTSCEMINGLIHTPVNASVP-----------DFHSIFIDVRDVALAH 251

  Fly   343 NYT-QPVN-LGNPVEQTIGEFAEIIKKLVGGPSVIKQSKAMEDDPQRR------KP--------- 390
            .|. |..| .|..:..|.|:|        |...::  ....||.||.|      ||         
Yeast   252 LYAFQKENTAGKRLVVTNGKF--------GNQDIL--DILNEDFPQLRGLIPLGKPGTGDQVIDR 306

  Fly   391 ----DITRARQLLHWE 402
                |.:..|::|.:|
Yeast   307 GSTTDNSATRKILGFE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 74/341 (22%)
UGD_SDR_e 116..419 CDD:187541 74/341 (22%)
YDR541CNP_010830.4 AR_SDR_e 4..320 CDD:187538 72/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.