DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and CCR2

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_178197.1 Gene:CCR2 / 844421 AraportID:AT1G80820 Length:332 Species:Arabidopsis thaliana


Alignment Length:300 Identity:71/300 - (23%)
Similarity:114/300 - (38%) Gaps:48/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KRILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRN-------VEHWLGHENFELIHHDIV 173
            |.:.:||..|::.|.:|..|:.:|:.|.......|..|.|       .:..|...:.:|:.::.:
plant     6 KLVCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLHSADLLDYEAL 70

  Fly   174 NPLFIEIDEIYHLASP-ASPPHYMYNPVKTIKTNTMGTINVLGLAKRVMAK--VLIASTSEVYGD 235
            .......|.::|.||| ...|..|..|.      ..|...|:..|.:...|  |..:|...||.:
plant    71 CATIDGCDGVFHTASPMTDDPETMLEPA------VNGAKFVIDAAAKAKVKRVVFTSSIGAVYMN 129

  Fly   236 PTVHPQ---PETYWGHVNPIGPRAC------YDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGP 291
            |....|   .|..|..::     .|      |..||.::|..::..||.:.|.:.|.......||
plant   130 PNRDTQAIVDENCWSDLD-----FCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGP 189

  Fly   292 RMH--MNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLGNPV 354
            .:.  :|...|   .||:.|.....| |.|  .|:.:..|.|:..|.:.:    |..|...|..:
plant   190 PLQSAINASLV---HILKYLTGSAKT-YAN--LTQVYVDVRDVALGHVLV----YEAPSASGRYI 244

  Fly   355 --EQTI--GEFAEIIKKLVGGPSVIKQSKAMEDDPQRRKP 390
              |..:  ||..||:.|..  |.....:|..::...|.||
plant   245 LAETALHRGEVVEILAKFF--PEYPLPTKCSDEKNPRAKP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 70/299 (23%)
UGD_SDR_e 116..419 CDD:187541 70/299 (23%)
CCR2NP_178197.1 NADB_Rossmann 5..332 CDD:389744 70/299 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D848823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.