DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxs and MUM4

DIOPT Version :9

Sequence 1:NP_648182.1 Gene:Uxs / 38911 FlyBaseID:FBgn0035848 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_564633.2 Gene:MUM4 / 841785 AraportID:AT1G53500 Length:667 Species:Arabidopsis thaliana


Alignment Length:325 Identity:90/325 - (27%)
Similarity:147/325 - (45%) Gaps:34/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KRILITGGAGFVGSHLVDDLM--VQGHEVIVVDNF-FTGRKRNVEHWLGHENFELIHHDI----- 172
            |.|||||.|||:.||:.:.|:  ...::::|:|.. :....:|::......||:.:..||     
plant     9 KNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFVKGDIASDDL 73

  Fly   173 VNPLFI--EIDEIYHLASPASPPHYMYNPVKTIKTNTMGTINVLGLAKRVMAKV---LIASTSEV 232
            ||.|.|  .||.|.|.|:.....:...|..:..|.|..|| :||..|.:|..::   :..||.||
plant    74 VNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGT-HVLLEACKVTGQIRRFIHVSTDEV 137

  Fly   233 YG----DPTVHPQPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPRM 293
            ||    |..|.....:.....||      |...|..:|.|..||.:...:.|...|..|.|||..
plant   138 YGETDEDAAVGNHEASQLLPTNP------YSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQ 196

  Fly   294 HMNDGRVVSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGM-IALMASNYTQPVNLGNPVEQT 357
            ...  :::..|||.|:..:.:.::|:|...||:.|..|:.:.. :.|.........|:|...|:.
plant   197 FPE--KMIPKFILLAMSGKPLPIHGDGSNVRSYLYCEDVAEAFEVVLHKGEIGHVYNVGTKRERR 259

  Fly   358 IGEFAEIIKKLVG-GPSVIKQSKAMEDDP---QRRKPDITRARQLLHWEPKVPLETGLQRTISYF 418
            :.:.|..|.||.| .|.  ...:.:|:.|   ||...|..:.:: |.|:.:...|.||::|:.::
plant   260 VIDVARDICKLFGKDPE--SSIQFVENRPFNDQRYFLDDQKLKK-LGWQERTNWEDGLKKTMDWY 321

  Fly   419  418
            plant   322  321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxsNP_648182.1 WcaG 116..424 CDD:223528 90/325 (28%)
UGD_SDR_e 116..419 CDD:187541 90/325 (28%)
MUM4NP_564633.2 PLN02260 3..667 CDD:215146 90/325 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D848823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.